DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and slc25a15.2

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001090866.1 Gene:slc25a15.2 / 100038284 XenbaseID:XB-GENE-973185 Length:302 Species:Xenopus tropicalis


Alignment Length:305 Identity:97/305 - (31%)
Similarity:150/305 - (49%) Gaps:36/305 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 NPV----KSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVR 74
            |||    .....|..||...||:|.|.||.||::||.|       .:|||..|||.||.:..|:|
 Frog     4 NPVIQAAIDLTAGAAGGTACVLTGQPFDTAKVKMQTFP-------TMYRGLMDCAVKTYRQMGLR 61

  Fly    75 GLYKGMSAPLTGVAPIFAMCFAGYALGKRLQQR----GEDAKLTYPQIFVAGSFSGLFSTLIMAP 135
            |.|:|.|..|.......::.|..|...:::.::    .::|:|:..|...:||.:.:|:.|::.|
 Frog    62 GFYRGTSPALLANIAENSVLFMSYGFCQKVVRQIVGLDKNAELSDVQNAASGSVASIFAALVLCP 126

  Fly   136 GERIKVLLQTQQGQGGERKYNGMI---------DCAGKLYKEGGLRSVFKGSCATMLRDLPANGL 191
            .|.:|..||...    |.:.:|.|         ...|.:.:||.| :.:.|..:|:.|::|...|
 Frog   127 TELVKCRLQAMH----ELQVSGKILQGQNTVWSVVKGIVQREGPL-AFYNGLTSTICREMPGYFL 186

  Fly   192 YFLVYEALQDV----AKSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKH 252
            :|..|||.:..    .|||.|.|.:   :.|.:||..|:|.|:...|.|.:|||:|.......:.
 Frog   187 FFGGYEASRSFFASGGKSKDELGPM---ALIVSGGFGGIALWLAVYPIDCVKSRIQVLSISGKQA 248

  Fly   253 GIRSVFKDLIVKDGPLALYRGVTPIMLRAFPANAACFFGIELANK 297
            |....|..::..:|.||||.|:.|.::||||||.|.|...|.:.:
 Frog   249 GFMKTFLHIVKNEGVLALYSGLKPTLIRAFPANGALFLAYEYSRR 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 34/96 (35%)
Mito_carr 112..202 CDD:395101 27/98 (28%)
Mito_carr 210..299 CDD:395101 31/88 (35%)
slc25a15.2NP_001090866.1 Mito_carr 9..93 CDD:365909 31/90 (34%)
Mito_carr 104..198 CDD:365909 27/98 (28%)
Mito_carr 208..297 CDD:365909 31/89 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54095
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.