DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment colt and slc25a47b

DIOPT Version :9

Sequence 1:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster
Sequence 2:NP_001083050.1 Gene:slc25a47b / 100006442 ZFINID:ZDB-GENE-070424-85 Length:288 Species:Danio rerio


Alignment Length:282 Identity:100/282 - (35%)
Similarity:144/282 - (51%) Gaps:21/282 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPLYRGTFDCAAKTIKNEGVRGLYKGMSAP 83
            ||.|..||...|..|:||||:||||||        |..|.|.:.|..||.:|||::|.|:|||.|
Zfish     6 FLAGSVGGAFGVAVGYPLDTVKVRLQT--------QTGYSGFWQCVRKTCRNEGLQGFYRGMSMP 62

  Fly    84 LTGVAPIFAMCFAGY----ALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTLIMAPGERIKVLLQ 144
            ::.|:...::.|..|    ....:||.|..........||:||...|:...|:|||.:.:||.||
Zfish    63 ISTVSISSSLVFGTYRNILQFLHQLQHRSAGEPHHKAHIFLAGFTGGVTQVLVMAPADIVKVRLQ 127

  Fly   145 TQQ------GQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVYEALQDVA 203
            .|.      .|....||.|.:.|..::.::.||..::|||.|..|||.|:...|||.|..:.::.
Zfish   128 CQTEPVQHISQESSSKYRGPVQCLLRIARDEGLLGLYKGSAALALRDGPSFATYFLTYNTICEIL 192

  Fly   204 KSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQ-SAPEGTYKHGIRSVFKDLIVKDGP 267
            .::::  :......:.||||:||..|.:|.|.||:||||| ....|....|........:..:|.
Zfish   193 TTENQ--RPGWPVVLLAGGVSGMCGWAVGTPMDVIKSRLQVDGVSGRRYRGFLHCITHSVRTEGS 255

  Fly   268 LALYRGVTPIMLRAFPANAACF 289
            ..|:||:|...:||||.|.:.|
Zfish   256 GVLFRGLTVNCIRAFPVNMSVF 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
coltNP_477221.1 Mito_carr 12..107 CDD:395101 37/91 (41%)
Mito_carr 112..202 CDD:395101 33/95 (35%)
Mito_carr 210..299 CDD:395101 29/81 (36%)
slc25a47bNP_001083050.1 Solcar 1 1..83 35/84 (42%)
PTZ00169 3..288 CDD:240302 100/282 (35%)
Mito_carr 3..85 CDD:278578 35/86 (41%)
Solcar 2 99..191 33/91 (36%)
Mito_carr 102..196 CDD:278578 32/93 (34%)
Mito_carr 197..288 CDD:278578 29/83 (35%)
Solcar 3 199..286 29/79 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072378at2759
OrthoFinder 1 1.000 - - FOG0000326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.