DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf10 and TAF10

DIOPT Version :9

Sequence 1:NP_477463.1 Gene:Taf10 / 33469 FlyBaseID:FBgn0028398 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_006275.1 Gene:TAF10 / 6881 HGNCID:11543 Length:218 Species:Homo sapiens


Alignment Length:125 Identity:69/125 - (55%)
Similarity:87/125 - (69%) Gaps:15/125 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QPDVEEVPLTTEESEMDELIKQLEDYSPTIPDALTMHILKTAGFCTVDPKIVRLVSVSAQKFISD 106
            :|.|...||.       :.:.|||||:||||||:|.:.|..|||...||:|:||:|::|||||||
Human   108 KPVVSSTPLV-------DFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISD 165

  Fly   107 IANDALQHCKTRTTNIQHSSGHSSSKDKKNPKDRKYTLAMEDLVPALADHGITMRKPQYF 166
            ||||||||||.:.|    :||.|.||.    |||||||.||||.|||:::||.::||.||
Human   166 IANDALQHCKMKGT----ASGSSRSKS----KDRKYTLTMEDLTPALSEYGINVKKPHYF 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf10NP_477463.1 TAF10 56..166 CDD:187739 63/109 (58%)
TAF10NP_006275.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..85
TAF10 115..217 CDD:187739 65/116 (56%)
[KR]-[STA]-K motif. /evidence=ECO:0000305|PubMed:16415881 187..189 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142509
Domainoid 1 1.000 74 1.000 Domainoid score I9183
eggNOG 1 0.900 - - E1_COG5162
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H86923
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1478962at2759
OrthoFinder 1 1.000 - - FOG0004416
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103784
Panther 1 1.100 - - O PTHR21242
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2306
SonicParanoid 1 1.000 - - X3131
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.740

Return to query results.
Submit another query.