DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf10 and taf10

DIOPT Version :9

Sequence 1:NP_477463.1 Gene:Taf10 / 33469 FlyBaseID:FBgn0028398 Length:167 Species:Drosophila melanogaster
Sequence 2:XP_031751865.1 Gene:taf10 / 550033 XenbaseID:XB-GENE-975335 Length:207 Species:Xenopus tropicalis


Alignment Length:173 Identity:73/173 - (42%)
Similarity:102/173 - (58%) Gaps:28/173 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GEDISVTPAESVTSATDTEEEDIDSPLMQSELHSDEEQPDVEEVPLTTEESEMDELIKQLEDYSP 69
            ||..:..||.:  :|..:|....:...:...:.:.:.:|.:...||.       :.:.|||||:|
 Frog    51 GERRASVPASA--AAAPSEGSLSNGVYLPPGVANGDVKPVISTTPLV-------DFLMQLEDYTP 106

  Fly    70 TIPDALTMHILKTAGFCTVDPKI-----------VRLVSVSAQKFISDIANDALQHCKTRTTNIQ 123
            |||||:|.:.|..|||...||:|           :||:|:::||||||||||||||||.:.|   
 Frog   107 TIPDAVTGYYLNRAGFEASDPRIDPLTPPLVSPRIRLISLASQKFISDIANDALQHCKMKGT--- 168

  Fly   124 HSSGHSSSKDKKNPKDRKYTLAMEDLVPALADHGITMRKPQYF 166
             :||.|.||.    ||:||||.||||.||||::||.::||.||
 Frog   169 -ASGSSRSKS----KDKKYTLTMEDLTPALAEYGINVKKPHYF 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf10NP_477463.1 TAF10 56..166 CDD:187739 62/120 (52%)
taf10XP_031751865.1 TAF10 93..206 CDD:187739 64/127 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I10012
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H86923
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1478962at2759
OrthoFinder 1 1.000 - - FOG0004416
OrthoInspector 1 1.000 - - otm47652
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3131
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.