DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf10 and taf-10

DIOPT Version :9

Sequence 1:NP_477463.1 Gene:Taf10 / 33469 FlyBaseID:FBgn0028398 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_504260.1 Gene:taf-10 / 3564983 WormBaseID:WBGene00006392 Length:179 Species:Caenorhabditis elegans


Alignment Length:178 Identity:54/178 - (30%)
Similarity:86/178 - (48%) Gaps:24/178 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASDGEDISVTP------------AESVTSATDTEEEDIDSPLMQSELHSDEE--QPDVEEVPLTT 52
            :|..|.:.:.|            |..|.|..:...:::.|.|.:....:.::  |..:|.|....
 Worm    10 SSSTESVLMPPPALPQYFQRPAAAPQVYSTLEPSVQNLRSSLHKPLTGNQQQFVQKTLENVQKNP 74

  Fly    53 EESEMDELIKQLEDYSPTIPDALTMHILKTAGFCTVDPKIVRLVSVSAQKFISDIANDALQHCKT 117
            .:.:..|.|.||.||.|||||::|:|.||:||....||::.|::|::|||.:|||..||:...:.
 Worm    75 SQDDTHEFINQLADYPPTIPDSVTLHFLKSAGVDGSDPRVTRMISLAAQKHVSDIILDAMTSARM 139

  Fly   118 RTTNIQHSSGHSSSKDKKNPKDRKYTLAMEDLVPALADHGITMRKPQY 165
            :          ...:.||..||.||||..|.|...|.::|....:|.|
 Worm   140 K----------GLGQTKKGTKDTKYTLTEELLDEILKEYGHQNTRPPY 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf10NP_477463.1 TAF10 56..166 CDD:187739 43/110 (39%)
taf-10NP_504260.1 TAF10 77..178 CDD:187739 43/111 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156814
Domainoid 1 1.000 55 1.000 Domainoid score I7419
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I3738
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57309
OrthoDB 1 1.010 - - D1478962at2759
OrthoFinder 1 1.000 - - FOG0004416
OrthoInspector 1 1.000 - - otm14123
orthoMCL 1 0.900 - - OOG6_103784
Panther 1 1.100 - - O PTHR21242
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2306
SonicParanoid 1 1.000 - - X3131
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.