DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf10 and Taf10

DIOPT Version :9

Sequence 1:NP_477463.1 Gene:Taf10 / 33469 FlyBaseID:FBgn0028398 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_001128207.1 Gene:Taf10 / 293345 RGDID:1305907 Length:218 Species:Rattus norvegicus


Alignment Length:127 Identity:70/127 - (55%)
Similarity:88/127 - (69%) Gaps:15/127 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EEQPDVEEVPLTTEESEMDELIKQLEDYSPTIPDALTMHILKTAGFCTVDPKIVRLVSVSAQKFI 104
            |.:|.|...||.       :.:.|||||:||||||:|.:.|..|||...||:|:||:|::|||||
  Rat   106 EVKPVVSSTPLV-------DFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFI 163

  Fly   105 SDIANDALQHCKTRTTNIQHSSGHSSSKDKKNPKDRKYTLAMEDLVPALADHGITMRKPQYF 166
            ||||||||||||.:.|    :||.|.||.    |||||||.||||.|||:::||.::||.||
  Rat   164 SDIANDALQHCKMKGT----ASGSSRSKS----KDRKYTLTMEDLTPALSEYGINVKKPHYF 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf10NP_477463.1 TAF10 56..166 CDD:187739 63/109 (58%)
Taf10NP_001128207.1 TAF10 115..217 CDD:187739 58/101 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336016
Domainoid 1 1.000 74 1.000 Domainoid score I8951
eggNOG 1 0.900 - - E1_COG5162
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H86923
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1478962at2759
OrthoFinder 1 1.000 - - FOG0004416
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103784
Panther 1 1.100 - - O PTHR21242
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3131
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.710

Return to query results.
Submit another query.