DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf10 and Taf10

DIOPT Version :10

Sequence 1:NP_477463.1 Gene:Taf10 / 33469 FlyBaseID:FBgn0028398 Length:167 Species:Drosophila melanogaster
Sequence 2:NP_064408.2 Gene:Taf10 / 24075 MGIID:1346320 Length:218 Species:Mus musculus


Alignment Length:127 Identity:70/127 - (55%)
Similarity:88/127 - (69%) Gaps:15/127 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EEQPDVEEVPLTTEESEMDELIKQLEDYSPTIPDALTMHILKTAGFCTVDPKIVRLVSVSAQKFI 104
            |.:|.|...||.       :.:.|||||:||||||:|.:.|..|||...||:|:||:|::|||||
Mouse   106 EVKPVVSSTPLV-------DFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFI 163

  Fly   105 SDIANDALQHCKTRTTNIQHSSGHSSSKDKKNPKDRKYTLAMEDLVPALADHGITMRKPQYF 166
            ||||||||||||.:.|    :||.|.||.    |||||||.||||.|||:::||.::||.||
Mouse   164 SDIANDALQHCKMKGT----ASGSSRSKS----KDRKYTLTMEDLTPALSEYGINVKKPHYF 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf10NP_477463.1 HFD_TAF10 56..160 CDD:467026 61/103 (59%)
Taf10NP_064408.2 PRK12323 <4..>115 CDD:481241 3/8 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..50
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 64..86
HFD_TAF10 115..211 CDD:467026 53/95 (56%)
[KR]-[STA]-K motif 187..189 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.