DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf10b and TAF10

DIOPT Version :9

Sequence 1:NP_477418.1 Gene:Taf10b / 33468 FlyBaseID:FBgn0026324 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_010451.3 Gene:TAF10 / 851745 SGDID:S000002574 Length:206 Species:Saccharomyces cerevisiae


Alignment Length:191 Identity:49/191 - (25%)
Similarity:74/191 - (38%) Gaps:58/191 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NSAGGASSHGQSSGGGGGGDRDR-------------------------------TTPSSHLSDFM 45
            |..|...:...|..|...||.|.                               |.....|.:.:
Yeast    14 NQEGQLETPFPSVAGADDGDNDNDDSVAENMKKKQKREAVVDDGSENAFGIPEFTRKDKTLEEIL 78

  Fly    46 SQLEDYTPLIPDAVTSHYLNMGGFQSDDKRIVRLISLAAQKYMSDIIDDALQHSKARTHMQTTNT 110
            ..::...|:|||||..:||...||...|.|:.||::||.||::|||..||.::|:.|:.:..:|.
Yeast    79 EMMDSTPPIIPDAVIDYYLTKNGFNVADVRVKRLLALATQKFVSDIAKDAYEYSRIRSSVAVSNA 143

  Fly   111 ----------------PG-----------GSKAKDRKFTLTMEDLQPALADYGINVRKVDY 144
                            ||           ..|....|..||:.||..|:|:||:|:.:.|:
Yeast   144 NNSQARARQLLQGQQQPGVQQISQQQHQQNEKTTASKVVLTVNDLSSAVAEYGLNIGRPDF 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf10bNP_477418.1 TAF10 41..144 CDD:187739 40/129 (31%)
TAF10NP_010451.3 COG5162 1..206 CDD:227491 49/191 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341782
Domainoid 1 1.000 56 1.000 Domainoid score I2692
eggNOG 1 0.900 - - E1_COG5162
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I1668
Isobase 1 0.950 - 0 Normalized mean entropy S1185
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004416
OrthoInspector 1 1.000 - - otm46549
orthoMCL 1 0.900 - - OOG6_103784
Panther 1 1.100 - - LDO PTHR21242
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2306
SonicParanoid 1 1.000 - - X3131
TreeFam 1 0.960 - -
1413.730

Return to query results.
Submit another query.