DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf10b and TAFII15

DIOPT Version :9

Sequence 1:NP_477418.1 Gene:Taf10b / 33468 FlyBaseID:FBgn0026324 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001329548.1 Gene:TAFII15 / 829300 AraportID:AT4G31720 Length:134 Species:Arabidopsis thaliana


Alignment Length:126 Identity:53/126 - (42%)
Similarity:77/126 - (61%) Gaps:9/126 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SHGQSSGGGGGGDRDRTTPSSHLSDFMSQLEDYTPLIPDAVTSHYLNMGGFQSDDKRIVRLISLA 83
            :|||.||.....|      .:.|::|::.|.||||.|||.:..|||...|||..|.|::||:::|
plant     2 NHGQQSGEAKHED------DAALTEFLASLMDYTPTIPDDLVEHYLAKSGFQCPDVRLIRLVAVA 60

  Fly    84 AQKYMSDIIDDALQHSKARTHMQTTNTPGGSKAKDRKFTLTMEDLQPALADYGINVRKVDY 144
            .||:::|:..|||||.|||......:.   .:.||::..||||||..||.:||:||:..:|
plant    61 TQKFVADVASDALQHCKARPAPVVKDK---KQQKDKRLVLTMEDLSKALREYGVNVKHPEY 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf10bNP_477418.1 TAF10 41..144 CDD:187739 46/102 (45%)
TAFII15NP_001329548.1 TAF10 16..119 CDD:187739 47/106 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5162
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57309
OrthoDB 1 1.010 - - D1478962at2759
OrthoFinder 1 1.000 - - FOG0004416
OrthoInspector 1 1.000 - - otm3575
orthoMCL 1 0.900 - - OOG6_103784
Panther 1 1.100 - - LDO PTHR21242
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3131
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.790

Return to query results.
Submit another query.