DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf10b and TAF10

DIOPT Version :9

Sequence 1:NP_477418.1 Gene:Taf10b / 33468 FlyBaseID:FBgn0026324 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_006275.1 Gene:TAF10 / 6881 HGNCID:11543 Length:218 Species:Homo sapiens


Alignment Length:139 Identity:77/139 - (55%)
Similarity:94/139 - (67%) Gaps:10/139 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SAGGAS-SHGQSSGG------GGGGDRDRTTPSSHLSDFMSQLEDYTPLIPDAVTSHYLNMGGFQ 70
            |||||: ..|..|.|      ...||......|:.|.||:.|||||||.||||||.:|||..||:
Human    81 SAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFE 145

  Fly    71 SDDKRIVRLISLAAQKYMSDIIDDALQHSKARTHMQTTNTPGGSKAKDRKFTLTMEDLQPALADY 135
            :.|.||:|||||||||::|||.:|||||.|.:   .|.:....||:||||:|||||||.|||::|
Human   146 ASDPRIIRLISLAAQKFISDIANDALQHCKMK---GTASGSSRSKSKDRKYTLTMEDLTPALSEY 207

  Fly   136 GINVRKVDY 144
            ||||:|..|
Human   208 GINVKKPHY 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf10bNP_477418.1 TAF10 41..144 CDD:187739 65/102 (64%)
TAF10NP_006275.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..85 3/3 (100%)
TAF10 115..217 CDD:187739 66/105 (63%)
[KR]-[STA]-K motif. /evidence=ECO:0000305|PubMed:16415881 187..189 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142508
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5162
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 138 1.000 Inparanoid score I4536
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1478962at2759
OrthoFinder 1 1.000 - - FOG0004416
OrthoInspector 1 1.000 - - oto89225
orthoMCL 1 0.900 - - OOG6_103784
Panther 1 1.100 - - LDO PTHR21242
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2306
SonicParanoid 1 1.000 - - X3131
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.