DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf10b and taf10

DIOPT Version :9

Sequence 1:NP_477418.1 Gene:Taf10b / 33468 FlyBaseID:FBgn0026324 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001038276.1 Gene:taf10 / 556710 ZFINID:ZDB-GENE-060526-334 Length:181 Species:Danio rerio


Alignment Length:143 Identity:74/143 - (51%)
Similarity:93/143 - (65%) Gaps:17/143 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SAGGASSHGQSSGGGG--------GGDRDRTTPSSHLSDFMSQLEDYTPLIPDAVTSHYLNMGGF 69
            ||..|:....|:...|        .||......::.|:||:.|||||||.||||||.:|||..||
Zfish    43 SASMATPSSDSTVSNGVYVPTEIANGDVKPVISTTPLADFLMQLEDYTPTIPDAVTGYYLNRAGF 107

  Fly    70 QSDDKRIVRLISLAAQKYMSDIIDDALQHSKARTHMQTTNTPGGS---KAKDRKFTLTMEDLQPA 131
            ::.|.||:||||||:||::|||.:|||||.|.:      .|..||   ||||:|:|||||||.||
Zfish   108 EASDPRIIRLISLASQKFISDIANDALQHCKMK------GTASGSSRNKAKDKKYTLTMEDLTPA 166

  Fly   132 LADYGINVRKVDY 144
            ||:|||||:|..|
Zfish   167 LAEYGINVKKPHY 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf10bNP_477418.1 TAF10 41..144 CDD:187739 66/105 (63%)
taf10NP_001038276.1 TAF10 78..180 CDD:187739 67/108 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575208
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5162
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I4592
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1478962at2759
OrthoFinder 1 1.000 - - FOG0004416
OrthoInspector 1 1.000 - - oto40944
orthoMCL 1 0.900 - - OOG6_103784
Panther 1 1.100 - - LDO PTHR21242
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2306
SonicParanoid 1 1.000 - - X3131
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.