DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf10b and Taf10

DIOPT Version :9

Sequence 1:NP_477418.1 Gene:Taf10b / 33468 FlyBaseID:FBgn0026324 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_477463.1 Gene:Taf10 / 33469 FlyBaseID:FBgn0028398 Length:167 Species:Drosophila melanogaster


Alignment Length:115 Identity:61/115 - (53%)
Similarity:81/115 - (70%) Gaps:5/115 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TTPSSHLSDFMSQLEDYTPLIPDAVTSHYLNMGGFQSDDKRIVRLISLAAQKYMSDIIDDALQHS 99
            ||..|.:.:.:.|||||:|.||||:|.|.|...||.:.|.:||||:|::|||::|||.:|||||.
  Fly    51 TTEESEMDELIKQLEDYSPTIPDALTMHILKTAGFCTVDPKIVRLVSVSAQKFISDIANDALQHC 115

  Fly   100 KAR-THMQTTNTPGGSK----AKDRKFTLTMEDLQPALADYGINVRKVDY 144
            |.| |::|.::....||    .||||:||.||||.|||||:||.:||..|
  Fly   116 KTRTTNIQHSSGHSSSKDKKNPKDRKYTLAMEDLVPALADHGITMRKPQY 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf10bNP_477418.1 TAF10 41..144 CDD:187739 57/107 (53%)
Taf10NP_477463.1 TAF10 56..166 CDD:187739 58/110 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440173
Domainoid 1 1.000 55 1.000 Domainoid score I7419
eggNOG 1 0.900 - - E1_COG5162
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I3738
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1478962at2759
OrthoFinder 1 1.000 - - FOG0004416
OrthoInspector 1 1.000 - - otm3575
orthoMCL 1 0.900 - - OOG6_103784
Panther 1 1.100 - - P PTHR21242
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2306
SonicParanoid 1 1.000 - - X3131
1211.830

Return to query results.
Submit another query.