DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf10b and Taf10

DIOPT Version :9

Sequence 1:NP_477418.1 Gene:Taf10b / 33468 FlyBaseID:FBgn0026324 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_001128207.1 Gene:Taf10 / 293345 RGDID:1305907 Length:218 Species:Rattus norvegicus


Alignment Length:139 Identity:75/139 - (53%)
Similarity:94/139 - (67%) Gaps:10/139 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SAGGAS-SHGQSSGG------GGGGDRDRTTPSSHLSDFMSQLEDYTPLIPDAVTSHYLNMGGFQ 70
            :||||: ..|..|.|      ...|:......|:.|.||:.|||||||.||||||.:|||..||:
  Rat    81 AAGGAAPPEGAMSNGVYALPSAANGEVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFE 145

  Fly    71 SDDKRIVRLISLAAQKYMSDIIDDALQHSKARTHMQTTNTPGGSKAKDRKFTLTMEDLQPALADY 135
            :.|.||:|||||||||::|||.:|||||.|.:   .|.:....||:||||:|||||||.|||::|
  Rat   146 ASDPRIIRLISLAAQKFISDIANDALQHCKMK---GTASGSSRSKSKDRKYTLTMEDLTPALSEY 207

  Fly   136 GINVRKVDY 144
            ||||:|..|
  Rat   208 GINVKKPHY 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf10bNP_477418.1 TAF10 41..144 CDD:187739 65/102 (64%)
Taf10NP_001128207.1 TAF10 115..217 CDD:187739 66/105 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336015
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5162
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4467
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1478962at2759
OrthoFinder 1 1.000 - - FOG0004416
OrthoInspector 1 1.000 - - oto96349
orthoMCL 1 0.900 - - OOG6_103784
Panther 1 1.100 - - LDO PTHR21242
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3131
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.