DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf10b and taf10

DIOPT Version :9

Sequence 1:NP_477418.1 Gene:Taf10b / 33468 FlyBaseID:FBgn0026324 Length:146 Species:Drosophila melanogaster
Sequence 2:NP_595927.1 Gene:taf10 / 2540614 PomBaseID:SPBC21H7.02 Length:215 Species:Schizosaccharomyces pombe


Alignment Length:130 Identity:48/130 - (36%)
Similarity:79/130 - (60%) Gaps:22/130 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RDRTTPSSHLSDFMSQLEDYTPLIPDAVTSHYLNMGGFQSDDKRIVRLISLAAQKYMSDIIDDAL 96
            :|:|     |.:|::|::||:|||||.:..:||::.||:..|.|:.:|:.|.|||::||:..||.
pombe    89 KDKT-----LENFLAQMDDYSPLIPDVLLDYYLSLSGFKCVDPRLKKLLGLTAQKFISDVAQDAY 148

  Fly    97 QHSKARTHMQTTNT---------PGGS-------KAKDR-KFTLTMEDLQPALADYGINVRKVDY 144
            |:||.||.....::         .||:       :..|| |..||::||..||.:||||:::.|:
pombe   149 QYSKIRTGSSNASSTTFGAQNFGAGGASGIGSSGRRGDRGKTVLTVDDLSAALNEYGINLKRPDF 213

  Fly   145  144
            pombe   214  213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Taf10bNP_477418.1 TAF10 41..144 CDD:187739 45/119 (38%)
taf10NP_595927.1 COG5162 2..215 CDD:227491 48/130 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 56 1.000 Domainoid score I3153
eggNOG 1 0.900 - - E1_COG5162
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I1779
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004416
OrthoInspector 1 1.000 - - otm47028
orthoMCL 1 0.900 - - OOG6_103784
Panther 1 1.100 - - LDO PTHR21242
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2306
SonicParanoid 1 1.000 - - X3131
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.