DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aph-1 and APH1B

DIOPT Version :9

Sequence 1:NP_001259963.1 Gene:aph-1 / 33467 FlyBaseID:FBgn0031458 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_112591.2 Gene:APH1B / 83464 HGNCID:24080 Length:257 Species:Homo sapiens


Alignment Length:248 Identity:111/248 - (44%)
Similarity:153/248 - (61%) Gaps:13/248 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTLPEFFGCTFIAFGPPFALFVFTIANDPVRIIILIAAAFFWLLSLLISSL-WY---ALIPLKE- 60
            ||...||||.||||||..||:|||||.:|:|||.|||.|||||:||||||| |:   .:|..|: 
Human     1 MTAAVFFGCAFIAFGPALALYVFTIATEPLRIIFLIAGAFFWLVSLLISSLVWFMARVIIDNKDG 65

  Fly    61 -----FLAFGVVFSVCFQEAFRYIIYRILRSTEQGLHAVAEDTRVTDNKHILAYVSGLGFGIISG 120
                 .|.||...||..||.||:..|::|:...:||.:: .......:..:|||||||||||:||
Human    66 PTQKYLLIFGAFVSVYIQEMFRFAYYKLLKKASEGLKSI-NPGETAPSMRLLAYVSGLGFGIMSG 129

  Fly   121 MFALVNVLADMSGPGTMGLKGGTELFFVTSAAQALSIILLHTFWSVIFFNAFDTNNYIHIGYVVF 185
            :|:.||.|:|..||||:|:.|.:..||:.||...|.|||||.||.::||:..:...:..:..|:.
Human   130 VFSFVNTLSDSLGPGTVGIHGDSPQFFLYSAFMTLVIILLHVFWGIVFFDGCEKKKWGILLIVLL 194

  Fly   186 SHLFVSLITLLNANELYTTTLLINYLVTILTGVLAFRVAGGTSRSFRKFITCQ 238
            :||.||..|.:::  .|...|...:::.:|.|..||..|||:.||.:..:.||
Human   195 THLLVSAQTFISS--YYGINLASAFIILVLMGTWAFLAAGGSCRSLKLCLLCQ 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aph-1NP_001259963.1 Aph-1 2..225 CDD:283708 103/232 (44%)
APH1BNP_112591.2 Aph-1 3..232 CDD:310594 102/231 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147794
Domainoid 1 1.000 220 1.000 Domainoid score I2627
eggNOG 1 0.900 - - E1_KOG3972
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 224 1.000 Inparanoid score I3522
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55474
OrthoDB 1 1.010 - - D1085102at2759
OrthoFinder 1 1.000 - - FOG0003244
OrthoInspector 1 1.000 - - otm40298
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR12889
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4469
SonicParanoid 1 1.000 - - X3174
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.900

Return to query results.
Submit another query.