DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aph-1 and LOC691658

DIOPT Version :9

Sequence 1:NP_001259963.1 Gene:aph-1 / 33467 FlyBaseID:FBgn0031458 Length:238 Species:Drosophila melanogaster
Sequence 2:XP_006243380.1 Gene:LOC691658 / 691658 RGDID:1597236 Length:262 Species:Rattus norvegicus


Alignment Length:213 Identity:91/213 - (42%)
Similarity:137/213 - (64%) Gaps:15/213 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 AAAFFWLLSLLISSLWYALI---------PLKEF-LAFGVVFSVCFQEAFRYIIYRILRSTEQGL 91
            |.|||||:|||:||:::.|:         |::.: |.|||:.|||.||.||...||:|:...:||
  Rat    42 ACAFFWLVSLLLSSVFWFLVRVITDNRDGPVQNYLLIFGVLLSVCIQELFRLAYYRLLKKANEGL 106

  Fly    92 HAV-AEDTRVTDNKHILAYVSGLGFGIISGMFALVNVLADMSGPGTMGLKGGTELFFVTSAAQAL 155
            .:: .|:|  ..:..:|||||||||||:||:|:.||.|::..||||:|:.|.:..||:.||...|
  Rat   107 KSINPEET--APSMRLLAYVSGLGFGIMSGVFSFVNTLSNALGPGTVGIHGDSPQFFLNSAFMTL 169

  Fly   156 SIILLHTFWSVIFFNAFDTNNYIHIGYVVFSHLFVSLITLLNANELYTTTLLINYLVTILTGVLA 220
            .||:||.||.::||:..:.|.:..:..|:.:||.||..|||:.:  |...|:..|::.:|.|:.|
  Rat   170 VIIMLHVFWGIVFFDGCEKNKWYILLTVLLTHLLVSTQTLLSPH--YEVNLVTAYIIMVLMGIWA 232

  Fly   221 FRVAGGTSRSFRKFITCQ 238
            |.||||:.||.:..:.||
  Rat   233 FCVAGGSRRSLKLCLLCQ 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aph-1NP_001259963.1 Aph-1 2..225 CDD:283708 84/198 (42%)
LOC691658XP_006243380.1 Aph-1 42..237 CDD:399242 84/198 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1085102at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.