DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aph-1 and zgc:114200

DIOPT Version :9

Sequence 1:NP_001259963.1 Gene:aph-1 / 33467 FlyBaseID:FBgn0031458 Length:238 Species:Drosophila melanogaster
Sequence 2:NP_001025300.1 Gene:zgc:114200 / 559336 ZFINID:ZDB-GENE-050913-96 Length:253 Species:Danio rerio


Alignment Length:246 Identity:114/246 - (46%)
Similarity:162/246 - (65%) Gaps:12/246 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTLPEFFGCTFIAFGPPFALFVFTIANDPVRIIILIAAAFFWLLSLLISSL-WYALIPL------ 58
            |||..||||.||||||.|||||||:|.||:|:|||||.|||||||||:||| |:..:..      
Zfish     1 MTLAVFFGCAFIAFGPAFALFVFTVAKDPLRVIILIAGAFFWLLSLLLSSLVWFIAVKASNSQDP 65

  Fly    59 ---KEFLAFGVVFSVCFQEAFRYIIYRILRSTEQGLHAVAEDTRVTDNKHILAYVSGLGFGIISG 120
               :..|.|||.|||..||.||:..||:||...:||.|:::|.....:...:|||:|||||::.|
Zfish    66 SLPRGLLIFGVFFSVLLQEVFRFAYYRLLRKATEGLAAISDDASSAISVRQMAYVAGLGFGVMRG 130

  Fly   121 MFALVNVLADMSGPGTMGLKGGTELFFVTSAAQALSIILLHTFWSVIFFNAFDTNNYIHIGYVVF 185
            .|:::|:|:|..||||:|:.|.::.:|:|:|...|::.||||||.|:||...:.:::..|..||.
Zfish   131 AFSMINILSDSLGPGTVGIFGDSQYYFITAALMTLALTLLHTFWGVLFFEGCEKSSWWVIAVVVS 195

  Fly   186 SHLFVSLITLLNANELYTTTLLINYLVTILTGVLAFRVAGGTSRSFRKFIT 236
            .||.|:.::||  |.||..:|...|.:|:|.|:.||..:||:.::.....|
Zfish   196 LHLLVAGLSLL--NPLYEGSLPPVYCITLLMGIWAFFSSGGSLQNLSALCT 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aph-1NP_001259963.1 Aph-1 2..225 CDD:283708 110/232 (47%)
zgc:114200NP_001025300.1 Aph-1 2..233 CDD:283708 110/232 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581640
Domainoid 1 1.000 220 1.000 Domainoid score I2561
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 227 1.000 Inparanoid score I3457
OMA 1 1.010 - - QHG55474
OrthoDB 1 1.010 - - D1085102at2759
OrthoFinder 1 1.000 - - FOG0003244
OrthoInspector 1 1.000 - - otm25633
orthoMCL 1 0.900 - - OOG6_104863
Panther 1 1.100 - - LDO PTHR12889
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3174
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.