DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment aph-1 and aph1a

DIOPT Version :9

Sequence 1:NP_001259963.1 Gene:aph-1 / 33467 FlyBaseID:FBgn0031458 Length:238 Species:Drosophila melanogaster
Sequence 2:XP_012808647.1 Gene:aph1a / 548560 XenbaseID:XB-GENE-921428 Length:265 Species:Xenopus tropicalis


Alignment Length:248 Identity:108/248 - (43%)
Similarity:160/248 - (64%) Gaps:12/248 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTLPEFFGCTFIAFGPPFALFVFTIANDPVRIIILIAAAFFWLLSLLISSL-WYALIPLKE---- 60
            |.|..||||||:||||..:||:.|||.||:::|||:|.:||||:|:|:||| |:..:.:..    
 Frog     1 MALAVFFGCTFVAFGPALSLFILTIAVDPLKVIILVAGSFFWLVSVLLSSLIWFISVQISNKNDA 65

  Fly    61 -----FLAFGVVFSVCFQEAFRYIIYRILRSTEQGLHAVAEDTRVTDNKHILAYVSGLGFGIISG 120
                 .|.||...||..||.|||..||:|:..::||..::||.|...:...:|||||..||||||
 Frog    66 NLQYGLLIFGAAVSVLLQETFRYAYYRLLKKADEGLATISEDGRSPISIQQMAYVSGFSFGIISG 130

  Fly   121 MFALVNVLADMSGPGTMGLKGGTELFFVTSAAQALSIILLHTFWSVIFFNAFDTNNYIHIGYVVF 185
            :|:::|:|||..|||.:|:.|.::.:|:|||...::|:.|||||.::||.|.:....:||..||.
 Frog   131 VFSVINILADAIGPGIVGVHGDSQYYFLTSAFLTMAIVFLHTFWGIVFFAACEKRKPLHIIGVVL 195

  Fly   186 SHLFVSLITLLNANELYTTTLLINYLVTILTGVLAFRVAGGTSRSFRKFITCQ 238
            |||..|.:|.|  |.:|..:|:..|::|:...:.||..|||..::.||.:.|:
 Frog   196 SHLVASGLTFL--NPMYEASLIPIYIITLGMALWAFVAAGGNYQNIRKCLACR 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
aph-1NP_001259963.1 Aph-1 2..225 CDD:283708 101/232 (44%)
aph1aXP_012808647.1 Aph-1 3..233 CDD:368748 101/231 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 207 1.000 Domainoid score I2832
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H9345
Inparanoid 1 1.050 216 1.000 Inparanoid score I3508
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1085102at2759
OrthoFinder 1 1.000 - - FOG0003244
OrthoInspector 1 1.000 - - oto102262
Panther 1 1.100 - - O PTHR12889
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4469
SonicParanoid 1 1.000 - - X3174
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.190

Return to query results.
Submit another query.