DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and SNX29

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_011521040.1 Gene:SNX29 / 92017 HGNCID:30542 Length:879 Species:Homo sapiens


Alignment Length:238 Identity:56/238 - (23%)
Similarity:94/238 - (39%) Gaps:77/238 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 FVVYE--LTVKQDGATEDTQPAKIERRYTDFRELYLGLKRQHPAEMANKYFPAKVLMGNFKSELI 155
            |.||:  :.:|.|       ...|.||||:||.|:..|:.::|...|..:.|.|.         |
Human   685 FHVYQVYIRIKDD-------EWNIYRRYTEFRSLHHKLQNKYPQVRAYNFPPKKA---------I 733

  Fly   156 GERSAAFEAFLTYVAS-QAMLRDSEYFLRFLQHDELTRA--CQFLDERRNEMAIPILENCFR-LL 216
            |.:.....|::|..|| .|.|..:...|......|:|.:  .:|::|||.:     |:|..| ::
Human   734 GNKPPPSPAWMTAAASLLASLLPALPPLNLQVTSEVTSSQDAKFVEERRKQ-----LQNYLRSVM 793

  Fly   217 NKIYMNRSRPVLLILCRLVAACTSSPVPHHAAERWALLALSRFETLCDIDLLPLYIP-------- 273
            ||:.                    ..||..||.       .:.|||  |.|:|.::.        
Human   794 NKVI--------------------QMVPEFAAS-------PKKETL--IQLMPFFVTSWCWDPEN 829

  Fly   274 LLHTC---------AHLWWQRG--QDQKPITDRLTDMSKQGIN 305
            ...||         :|.|...|  :..:||:::  ::..:|::
Human   830 QTQTCLQGTLGYCQSHFWISCGWWKSWRPISNQ--EVGGKGLD 870

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 27/97 (28%)
SNX29XP_011521040.1 RUN 54..189 CDD:280855
Ax_dynein_light <487..552 CDD:287215
PX_RUN 668..820 CDD:132810 48/184 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.