DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and MDM1

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_013603.1 Gene:MDM1 / 854867 SGDID:S000004572 Length:1127 Species:Saccharomyces cerevisiae


Alignment Length:106 Identity:30/106 - (28%)
Similarity:43/106 - (40%) Gaps:24/106 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 RRYTDFRELYLGLKRQHPAEM--ANKYFPAKVLMG----NFKSELIGERSAAFEAFLTYVASQAM 174
            |||.:|.||...||:.....|  ....||:||.|.    ..|:.|..||....|.:|..:.|.:.
Yeast   823 RRYNEFFELNTYLKKNFRDLMRQLQDLFPSKVKMSLKYHVTKTLLYEERKQKLEKYLRELLSISE 887

  Fly   175 LRDSEYFLRFL------------QHDELTRACQFLDERRNE 203
            :.:...|.|||            .||::      |:|..:|
Yeast   888 ICEDNIFRRFLTDPTPFKLNKEYMHDDI------LEEPLHE 922

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 25/89 (28%)
MDM1NP_013603.1 PXA 85..276 CDD:214611
RGS 462..567 CDD:413378
PX_MDM1p 763..900 CDD:132786 25/76 (33%)
Nexin_C 993..1106 CDD:400794
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.