DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and snx20

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_005163245.1 Gene:snx20 / 794759 ZFINID:ZDB-GENE-100806-1 Length:309 Species:Danio rerio


Alignment Length:284 Identity:84/284 - (29%)
Similarity:119/284 - (41%) Gaps:34/284 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 HAVMAKRLH---HQPTFDGDPPGPDELDSPAIEAAALDIPPPESDKALQKGVWERATSAEYKPTT 65
            |.|.:...|   ||.|..|:  |....|.....|:.|      :...||:. | ||...|::   
Zfish    14 HTVSSAPEHLSPHQETLQGN--GESAEDDLCFGASCL------TTAELQQH-W-RAVKQEFR--- 65

  Fly    66 DGSTVLRFDILLAHIMPPDGEDVKIKRFVVYELTVKQDGATEDTQPAKIERRYTDFRELYLGLKR 130
              |..|.|||..|.|:     ...|.:.|||::.|.:.| :.|.:...|||||:||..|:..|..
Zfish    66 --SVKLLFDIPSARII-----SQTISKHVVYQVVVIRSG-SYDCERVAIERRYSDFLHLHQELLS 122

  Fly   131 QHPAEMANKYFPAKVLMGNFKSELIGERSAAFEAFLTYVASQAMLRDSEYFLRFLQHDELTRACQ 195
            ....|:.:..||.|.:..||..|:|.||..|...:||.:.|...:|.|:.|..|..|.||..|..
Zfish   123 DFSEELEDVVFPKKKMTRNFSEEIIAERRVALRDYLTQLYSLRFVRKSQAFQSFFTHQELKSAYD 187

  Fly   196 FLDERRNEMAIPILENCFRLLNKIYMNRSRPVLLILCRLVAACTSSPVPHHAA---ERWALLALS 257
            .|...|...|:..|:....|..|:..:.:..|:..||.:: .|........||   .|.||..:.
Zfish   188 LLRGGRFSRALEGLQKVLVLQEKLSSHDATLVIPTLCAIL-VCQRDLEDFEAAFETGRKALPTVR 251

  Fly   258 RFETLCDIDLLPLYIPLLHTCAHL 281
            |:|      |...:.|||.....|
Zfish   252 RYE------LRKHHGPLLEALVDL 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 40/116 (34%)
snx20XP_005163245.1 PX_domain 69..182 CDD:295365 41/118 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596057
Domainoid 1 1.000 70 1.000 Domainoid score I9507
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5077
OMA 1 1.010 - - QHG49711
OrthoDB 1 1.010 - - D1322681at2759
OrthoFinder 1 1.000 - - FOG0004256
OrthoInspector 1 1.000 - - otm25819
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20939
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.