DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and Snx16

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_083344.3 Gene:Snx16 / 74718 MGIID:1921968 Length:344 Species:Mus musculus


Alignment Length:216 Identity:50/216 - (23%)
Similarity:90/216 - (41%) Gaps:58/216 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DELDS------------------PAIEAAALDIPPPESDKALQKGV-WERATSAEYKPTTDGSTV 70
            |::||                  .:||.:|   .|.|:::...:.| ||.      :|:|  .|:
Mouse    59 DQMDSASSMCGSPLIRTKFTGTDSSIEYSA---RPREAEEQHPEAVNWED------RPST--PTI 112

  Fly    71 LRFDILLAHIMPPDGEDVKIKRFVVYELTVKQDGATEDTQPAKIERRYTDFRELYLGLKRQHPA- 134
            |.::::           .:..:|.||::.||:  :.|::.  .:.||||||..|...||...|. 
Mouse   113 LGYEVM-----------EERAKFTVYKILVKK--SPEESW--VVFRRYTDFSRLNDKLKEMFPGF 162

  Fly   135 EMANKYFPAKVLMGNFKSELIGERSAAFEAFLTYVASQAMLRDSEYFLRFLQHD---------EL 190
            .:|..  |.:....|:.:|.:.:|....:|||..:.:...:.:......||..|         |.
Mouse   163 RLALP--PKRWFKDNYNAEFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEE 225

  Fly   191 TRA-CQFLDERRNEMAIPILE 210
            :|| |:.|:|....:...:||
Mouse   226 SRAFCETLEETNYHLQRELLE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 27/117 (23%)
Snx16NP_083344.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..72 3/12 (25%)
PX_SNX16 105..214 CDD:132809 30/133 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.