DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and snx15

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001093667.1 Gene:snx15 / 734054 XenbaseID:XB-GENE-492800 Length:342 Species:Xenopus tropicalis


Alignment Length:118 Identity:28/118 - (23%)
Similarity:52/118 - (44%) Gaps:14/118 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KRFVVYELTVK--QDGATEDTQPAKIERRYTDFRELYLGLKRQHPAEMANKY--------FPAKV 145
            |.|..|::|.:  .....:|.:...:.:||:||::|:..|...|    .|.:        ||...
 Frog    25 KGFTEYKVTAQFISKKNPQDVKEVLVWKRYSDFKKLHGELSYTH----RNLFQRCQEFPPFPRAQ 85

  Fly   146 LMGNFKSELIGERSAAFEAFLTYVASQAMLRDSEYFLRFLQHDELTRACQFLD 198
            :.|.|::.:|.||..|.|..|.:..:...|.:|.....|.:..|:::..:..|
 Frog    86 VFGRFEAPVIEERRQAAEDMLKFTVNIPALYNSPQLKDFFREGEVSQQAEGQD 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 26/106 (25%)
snx15NP_001093667.1 PX_SNX15 11..128 CDD:132821 26/106 (25%)
MIT_SNX15 267..340 CDD:239140
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.