DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and Snx15

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_081188.1 Gene:Snx15 / 69024 MGIID:1916274 Length:337 Species:Mus musculus


Alignment Length:301 Identity:64/301 - (21%)
Similarity:98/301 - (32%) Gaps:97/301 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KRFVVYELTV----KQDGATEDTQPAKIERRYTDFRELYLGLKRQH----------PAEMANKYF 141
            |.:..|::|.    |:|  .||.:...:.:||:|||:|:..|...|          ||      |
Mouse    23 KGYTEYKVTAQFISKKD--PEDIKEVVVWKRYSDFRKLHGDLAYTHRNLFRRLEEFPA------F 79

  Fly   142 PAKVLMGNFKSELIGERSAAFEAFLTYVASQAMLRDSEYFLRFLQHDELTRACQFLDERRNEMAI 206
            |...:.|.|::.:|.||....|..|.:......|.:|.....|.:..|:||..:...:.| .:..
Mouse    80 PRAQVFGRFEASVIEERRKGAEDLLRFTVPIPALNNSPQLKEFFRGGEVTRPSEVSRDLR-ILPP 143

  Fly   207 PIL----ENCFRLLNKIYMNR--------------SRPV-----LLILCRLVAACTSS------- 241
            |::    .:..|||..:...|              |.|.     ||..|......:||       
Mouse   144 PLIPTPPPDEARLLQPLPAERRGQEELEVPVDPLPSSPAQEALDLLFSCDSTEEASSSLARGPLS 208

  Fly   242 -----------------PVPHHAAERWALLALSR-------------FETLCDIDLLPLYIPLLH 276
                             |.|.|..|..|:...|:             .|...|.:..|.|:    
Mouse   209 EAELALFDPYSKEESTGPSPTHTGELAAIEVESKRLDQEPWEPGGQEEEEAEDGEPAPAYL---- 269

  Fly   277 TCAHLWWQRGQDQKPITDRLTDMSKQGINTANTESLMQAIH 317
                     ||..:.||..|.: .|.|...|..:.....:|
Mouse   270 ---------GQATELITQALRN-EKAGAYAAALQGYQDGVH 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 29/110 (26%)
Snx15NP_081188.1 PX_domain 9..126 CDD:383026 29/110 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 133..156 2/23 (9%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..270 4/38 (11%)
MIT_SNX15 267..337 CDD:239140 10/48 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.