Sequence 1: | NP_608709.1 | Gene: | Snx21 / 33466 | FlyBaseID: | FBgn0031457 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_081188.1 | Gene: | Snx15 / 69024 | MGIID: | 1916274 | Length: | 337 | Species: | Mus musculus |
Alignment Length: | 301 | Identity: | 64/301 - (21%) |
---|---|---|---|
Similarity: | 98/301 - (32%) | Gaps: | 97/301 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 91 KRFVVYELTV----KQDGATEDTQPAKIERRYTDFRELYLGLKRQH----------PAEMANKYF 141
Fly 142 PAKVLMGNFKSELIGERSAAFEAFLTYVASQAMLRDSEYFLRFLQHDELTRACQFLDERRNEMAI 206
Fly 207 PIL----ENCFRLLNKIYMNR--------------SRPV-----LLILCRLVAACTSS------- 241
Fly 242 -----------------PVPHHAAERWALLALSR-------------FETLCDIDLLPLYIPLLH 276
Fly 277 TCAHLWWQRGQDQKPITDRLTDMSKQGINTANTESLMQAIH 317 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Snx21 | NP_608709.1 | PX_SNX20_21_like | 71..188 | CDD:132812 | 29/110 (26%) |
Snx15 | NP_081188.1 | PX_domain | 9..126 | CDD:383026 | 29/110 (26%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 133..156 | 2/23 (9%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 244..270 | 4/38 (11%) | |||
MIT_SNX15 | 267..337 | CDD:239140 | 10/48 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2101 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |