DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and SNX16

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_071416.2 Gene:SNX16 / 64089 HGNCID:14980 Length:344 Species:Homo sapiens


Alignment Length:218 Identity:49/218 - (22%)
Similarity:91/218 - (41%) Gaps:60/218 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PDELD-------SPAIE------AAALDIP--PPESDKALQKGV-WERATSAEYKPTTDGSTVLR 72
            ||::|       ||.|.      |::::..  |.::::...:.| ||.      :|:|  .|:|.
Human    58 PDQMDNTSSVCSSPLIRTKFTGTASSIEYSTRPRDTEEQNPETVNWED------RPST--PTILG 114

  Fly    73 FDILLAHIMPPDGEDVKIKRFVVYELTVKQDGATEDTQPAKIERRYTDFRELYLGLKRQHPAEMA 137
            ::::           .:..:|.||::.||:  ..|::.  .:.||||||..|...||...|.   
Human   115 YEVM-----------EERAKFTVYKILVKK--TPEESW--VVFRRYTDFSRLNDKLKEMFPG--- 161

  Fly   138 NKYF-----PAKVLMGNFKSELIGERSAAFEAFLTYVASQAMLRDSEYFLRFLQHD--------- 188
               |     |.:....|:.::.:.:|....:|||..:.:...:.:......||..|         
Human   162 ---FRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSL 223

  Fly   189 ELTRA-CQFLDERRNEMAIPILE 210
            |.:|| |:.|:|....:...:||
Human   224 EESRAFCETLEETNYRLQKELLE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 26/121 (21%)
SNX16NP_071416.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..66 3/7 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..107 5/31 (16%)
PX_SNX16 105..214 CDD:132809 29/137 (21%)
SMC_N <231..>336 CDD:330553 4/16 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.