DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and SNX14

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001337461.1 Gene:SNX14 / 57231 HGNCID:14977 Length:967 Species:Homo sapiens


Alignment Length:186 Identity:37/186 - (19%)
Similarity:61/186 - (32%) Gaps:52/186 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PPDGEDVKIKRFVVYELTVKQD---GATEDTQPAKIERRYTDFRELYLGLKRQHPAEMANKYFPA 143
            |......|.:|..|:.:.|:::   ....:.:...:.|||.:|..|...|...|.| ..:...|:
Human   599 PSSERKEKKERIPVFCIDVERNDRRAVGHEPEHWSVYRRYLEFYVLESKLTEFHGA-FPDAQLPS 662

  Fly   144 KVLMGNFKSELIGERSAAFEAFLTYVASQAMLRDSEYFLRFLQHDELTRA-------------CQ 195
            |.::|....|.:..:...|:               ||..:.|||.||:.:             .|
Human   663 KRIIGPKNYEFLKSKREEFQ---------------EYLQKLLQHPELSNSQLLADFLSPNGGETQ 712

  Fly   196 FLD--------------------ERRNEMAIPILENCFRLLNKIYMNRSRPVLLIL 231
            |||                    :.:.:...|.:.|............|||.|.||
Human   713 FLDKILPDVNLGKIIKSVPGKLMKEKGQHLEPFIMNFINSCESPKPKPSRPELTIL 768

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 22/108 (20%)
SNX14NP_001337461.1 PXA 151..320 CDD:308031
RGS_SNX14 361..487 CDD:188677
PX_SNX14 585..707 CDD:132787 25/123 (20%)
Nexin_C 828..932 CDD:312222
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.