DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and KIF16B

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_005260807.1 Gene:KIF16B / 55614 HGNCID:15869 Length:1883 Species:Homo sapiens


Alignment Length:286 Identity:68/286 - (23%)
Similarity:102/286 - (35%) Gaps:65/286 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FDGDPPGPDELDSPAIEAA-ALDIPPPESDKALQKGVWERATSAEYKPTTD-----GSTVLRFDI 75
            |..:..|.:|||:..:.:: :|.....|.:..|  |.:....|..||.|:.     |:.|:....
Human  1367 FYSEQQGEEELDAKKMSSSESLVNIRTEGNNGL--GYFYHKFSDLYKDTSSHLLQAGTKVISQAR 1429

  Fly    76 LLAHIMPPDGEDVKIKRFV---------VYELTVKQD-GATEDTQPAKIERRYTDFRELYLGLKR 130
            |:.::..|.|...::..||         ...:.:|.| .:||...|   |.|.........|..|
Human  1430 LVGNLCAPRGLPSQVTTFVRSLPFLKHLAPHMPLKTDMQSTESHSP---EARVGSSESEAAGSLR 1491

  Fly   131 QHPAEMANKY----FPAKVLMGNFKSELI------GERSAAFEAFLTYVASQAMLRDSEYFLRFL 185
              |||.|..|    |.|..|.|:..|.:.      ..:|:||:..|.....| ||:..|..|:  
Human  1492 --PAEGAAPYRASVFAATGLPGSSPSSVFRLEYEDARKSSAFKQSLVQFPDQ-MLKLQECPLK-- 1551

  Fly   186 QHDELTRACQFLDERRNEMAIPILENCFRLLNKIYMNRSRPVLLILCRLVAACTSSPVPHHA--- 247
              |.|......|.|....|                    :.|..|....||||| :|.|..|   
Human  1552 --DLLRHVTCSLPEPLGNM--------------------KEVKGIYWLAVAACT-APDPQPACLL 1593

  Fly   248 ---AERWALLALSRFETLCDIDLLPL 270
               :..:||:......::.....|||
Human  1594 LLQSTLYALVLSDNLGSMSIFHALPL 1619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 33/136 (24%)
KIF16BXP_005260807.1 KISc_KIF1A_KIF1B 2..365 CDD:276816
KISc 3..365 CDD:214526
Kinesin_assoc 364..476 CDD:292801
FHA 478..543 CDD:278899
TPH 610..934 CDD:290579
GBP_C <618..818 CDD:303769
coiled coil 808..818 CDD:293879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.