DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and snx13

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_021323912.1 Gene:snx13 / 503733 ZFINID:ZDB-GENE-050306-12 Length:966 Species:Danio rerio


Alignment Length:247 Identity:57/247 - (23%)
Similarity:87/247 - (35%) Gaps:64/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IHAVMAKRLHHQPTFDGDPPGPDELDSPAIEAAALDIPPPESDKALQKGVWERATSAEYKPTTDG 67
            ::.:|.|..|:.|:|...|.....|       |.||:....|.:....|..|   |....||  |
Zfish   491 VYDMMLKHEHYYPSFRQHPLYVRML-------AELDMLKEPSYRGSDDGDGE---SFNGSPT--G 543

  Fly    68 STVLRFDILLA---------HIMPPDGEDVKI-------------KRFVVYELTV--KQDGATED 108
            |..|..|.|.:         |....|..|..:             |.:.:|.:||  |....:||
Zfish   544 SINLSLDDLSSGSVDESVQLHAFISDTADAFLNPLPVAGVCNDHGKTYALYTITVIRKNSDGSED 608

  Fly   109 TQPAKIERRYTDFRELYLGLKRQHPAEMANKYFPAKVLMGNFKSELIGERSAAFEAFLTYVASQA 173
            |.  |..|||:||.:.::.:..|..:.......|.|....|...|.:.:|.              
Zfish   609 TW--KTYRRYSDFHDFHMRITEQFESLAPILKLPGKKTFNNMDREFLEKRK-------------- 657

  Fly   174 MLRDSEYFLRFLQHDELTRACQFLDERRNEMAIPILENCFRLLNKIYMNRSR 225
              :|...:|:.|.:.|:.:||..|        :|.:.:.  |.||.|....|
Zfish   658 --KDLNAYLQLLLNPEMVKACPIL--------MPYVYDF--LENKAYSKGKR 697

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 29/140 (21%)
snx13XP_021323912.1 PXA 98..284 CDD:321992
RGS 378..513 CDD:321993 6/21 (29%)
PX_SNX13 559..690 CDD:132783 32/158 (20%)
Nexin_C 806..915 CDD:312222
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.