DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and CG7156

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_650697.1 Gene:CG7156 / 42187 FlyBaseID:FBgn0038588 Length:681 Species:Drosophila melanogaster


Alignment Length:185 Identity:44/185 - (23%)
Similarity:67/185 - (36%) Gaps:44/185 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DELDSPAIEAAALDIPP--PESDK-----ALQKGVWERATSAEYKPTTDGSTVLRFDIL-----L 77
            |:||.|.....|..|.|  |..||     ..|....|.....:.:|.||.:...| |.|     :
  Fly   169 DKLDLPYDPHDAGGITPLDPRCDKEQTNNESQAKETEIELETKQEPKTDVALTKR-DYLRLLTPM 232

  Fly    78 AHIMPPDGEDVKIKRFVVYELTVKQDGATEDTQPAKIERRYTDFRELYLGLKRQHPAEMANKYFP 142
            |.|...|.:       .:||..::...|.:    |::...|.:..|.|     :|..::      
  Fly   233 ASIESDDSD-------YIYEAALEFSHAVQ----AEVNLEYAEAHERY-----KHGVDL------ 275

  Fly   143 AKVLMGNFKSELIGERSAAFEAFLT-YVASQAMLRDSEYFLRFLQHDELTRACQF 196
               |:...|.:...||....:|.:. |:|     |..|....||.:|..|:..||
  Fly   276 ---LLNGAKQDSSEERRFIAKAKIAKYLA-----RAEEIHANFLANDCPTKKLQF 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 25/122 (20%)
CG7156NP_650697.1 PX_SNX15_like 8..124 CDD:132791
MIT_SNX15 241..315 CDD:239140 19/103 (18%)
PKc_like 343..665 CDD:304357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.