DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and snx15

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001104707.1 Gene:snx15 / 393352 ZFINID:ZDB-GENE-040426-1377 Length:398 Species:Danio rerio


Alignment Length:255 Identity:55/255 - (21%)
Similarity:82/255 - (32%) Gaps:87/255 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 FVVYELTVKQDGATE---------DTQPAKIE-----RRYTDFRELYLGLKRQHPAEMANKY--- 140
            |.|.:....:.|.||         .|||..::     :|||:.::|:..|...|    .|.:   
Zfish    14 FSVTDPRTHEKGHTEYKVTARFVSKTQPENVKEVVVWKRYTELKKLHGELAYTH----RNLFRRQ 74

  Fly   141 -----FPAKVLMGNFKSELIGERSAAFEAFLTYVASQAMLRDSEYFLRFLQHDELTRACQFLDER 200
                 ||...:.|.|...:|.||..|.||.|.:..:...|.:|.....|.:..|:.|.       
Zfish    75 EEFPPFPRAQVFGRFDEAVIEERRNAAEAMLLFTTNIPALYNSPQLKEFFRDGEVRRP------- 132

  Fly   201 RNEMAIPILENCFRLLNKIYMNRSRPVLLILCRLVAACTSSPVPHHAAERWALLALSRFETLCDI 265
                           |....::.|.|..||           |:|..:|:   |||.....|...|
Zfish   133 ---------------LETAVISTSLPPPLI-----------PLPERSAD---LLAEEETGTEAPI 168

  Fly   266 DLLPLYIPLLHTCAHLWWQRGQDQKPITDRLTDMSKQGINTANTESLMQAIHKIDPRTET 325
            ....|                    ....||||:::..|   ..|:|...  :..|..||
Zfish   169 QAQEL--------------------DSNQRLTDLTQPEI---AVEALSDT--RSSPTQET 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 29/116 (25%)
snx15NP_001104707.1 PX_SNX15 10..127 CDD:132821 29/116 (25%)
MIT_SNX15 321..395 CDD:239140
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.