DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and Snx16

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_611252.1 Gene:Snx16 / 37015 FlyBaseID:FBgn0034265 Length:407 Species:Drosophila melanogaster


Alignment Length:146 Identity:40/146 - (27%)
Similarity:59/146 - (40%) Gaps:12/146 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 TSAEYKPTTDGSTVLRFDILLAHIMPPDGEDVKIKRFVVYELTVKQDGATEDTQPAKIERRYTDF 121
            :|....|..|.:.|||..|:...:|.      :..||..|:|.|:.   .|......:.||||||
  Fly   208 SSGSVVPPVDPNAVLRVPIIGYEVME------ERARFTAYKLRVEN---PETNDYWLVMRRYTDF 263

  Fly   122 RELYLGLKRQHPAEMANKYFPAKVLMG-NFKSELIGERSAAFEAFLTYVASQAMLRDSEYFLRFL 185
            ..|...||:..|  ......|.|.|.| ||.:..:..|....:.|:..|.::..||..:....|.
  Fly   264 VRLNSKLKQAFP--NLTLMLPRKKLFGDNFNAVFLDNRVQGLQIFVNSVMAKEELRKCKLVREFF 326

  Fly   186 QHDELTRACQFLDERR 201
            ..||.....:.::|.|
  Fly   327 CLDEPPSYSESMEECR 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 32/117 (27%)
Snx16NP_611252.1 PX_SNX16 219..329 CDD:132809 33/120 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.