DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and Snx13

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_006240084.1 Gene:Snx13 / 362731 RGDID:1309778 Length:1144 Species:Rattus norvegicus


Alignment Length:223 Identity:50/223 - (22%)
Similarity:86/223 - (38%) Gaps:38/223 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PIHAVMAKRLH--HQPTFDGDPPGPDEL--DSP--AIEAAALDIPPPESDKALQKGVWERAT-SA 59
            |::..|...|.  ..|:|.|...|..|.  .||  :|..:..|:....||.::|...:...| .|
  Rat   683 PLYVRMLAELDMLKDPSFRGSDDGDGESFNGSPTGSINLSLDDLSSVTSDDSVQLHAYISDTVYA 747

  Fly    60 EYKPTTDGSTVLRFDILLAHIMPPDGEDVKIKRFVVYELTV-KQDGATEDTQPAKIERRYTDFRE 123
            :|.|           ..:|.:....|     |.:.:|.:|| ::...||:..  |..|||:||.:
  Rat   748 DYDP-----------YAVAGVCNDHG-----KTYALYAITVHRRSLNTEEMW--KTYRRYSDFHD 794

  Fly   124 LYLGLKRQHPAEMANKYFPAKVLMGNFKSELIGERSAAFEAFLTYVASQAMLRDSEYFLR----F 184
            .::.:..|.....:....|.|....|...:.:.:|.....|:|..:.:..||:.|.....    |
  Rat   795 FHMRITEQFENLSSILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLTPEMLKASPALAHCVYDF 859

  Fly   185 LQH--------DELTRACQFLDERRNEM 204
            |::        |...:...|::..||.|
  Rat   860 LENKAYSKGKGDFARKMDTFVNPLRNSM 887

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 26/129 (20%)
Snx13XP_006240084.1 PXA 273..460 CDD:295366
RGS_SNX13 553..687 CDD:188674 1/3 (33%)
PX_SNX13 733..863 CDD:132783 31/147 (21%)
Nexin_C 979..1087 CDD:285792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.