DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and snz

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001284993.1 Gene:snz / 31704 FlyBaseID:FBgn0029976 Length:1117 Species:Drosophila melanogaster


Alignment Length:273 Identity:58/273 - (21%)
Similarity:98/273 - (35%) Gaps:98/273 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PDELDSPAIE------AAALDIPPPESDKALQKGVWERATSAE-YKPTTDGS------TVLRFDI 75
            ||.::...::      |||          |:.|..:|.|.|.| :....:.|      :::|..|
  Fly   291 PDYINQKVVQNIETRLAAA----------AMSKRSYEYAASFEDFLKIINNSGNLEELSLIRKSI 345

  Fly    76 L--LAHI-----------MPPDGED-----------VKIKRFVVYELTVKQDGATE--------- 107
            :  |.|.           :.||.||           |::||: |.:||:.: |..|         
  Fly   346 VNDLMHATTMQNLQRAKGLDPDHEDHSLSKSELTAAVRLKRY-VRQLTMAK-GECEKNLAKFGWN 408

  Fly   108 -----DTQPAKIE-------RRY-TDFRE---------LYLG---LKRQHPA---EMANKYFPAK 144
                 |.....:|       ||| |.|.|         .||.   :|..|.:   ::..:.|...
  Fly   409 GNYSSDIDLTLVEILNTAVGRRYFTLFLEPLKASALIGFYLAVEEIKHAHKSASHQLGTEIFYTY 473

  Fly   145 VLMGNFKSELIGERSAAFEAFLT--------YVASQAMLR--DSEYFLRFLQHDELTRACQFLDE 199
            :.:...:.::........|.||.        |...:.:||  :.:|:..|:..|:..:..:.||.
  Fly   474 IRVPKSEIQIDKHERKLIETFLLGDAEPDIFYDIQRNVLRTLEEKYYPPFVLSDQYRQLKEALDS 538

  Fly   200 RRNEMAIPILENC 212
              ||:|.|.|..|
  Fly   539 --NEIADPTLLMC 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 37/187 (20%)
snzNP_001284993.1 PXA 142..299 CDD:280373 2/7 (29%)
RGS_SNX25 422..531 CDD:188675 20/108 (19%)
PX_SNX25 645..788 CDD:132788
Nexin_C 882..987 CDD:285792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.