DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and Snx14

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_038937462.1 Gene:Snx14 / 315871 RGDID:1310921 Length:984 Species:Rattus norvegicus


Alignment Length:205 Identity:36/205 - (17%)
Similarity:63/205 - (30%) Gaps:78/205 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PPDGEDVKIKRFVVYELTVKQD---GATEDTQPAKIERRYTDFRELYLGLKRQHPAEMANKYFPA 143
            |......|.:|..|:.:.|:::   ....:.:...:.|||.:|..|...|...| ....:...|:
  Rat   605 PSSERKEKKERIPVFCIDVERNDRRAVGHEPEHWSVYRRYLEFYVLESKLTEFH-GTFPDAQLPS 668

  Fly   144 KVLMGNFKSELIGERSAAFEAFLTYVASQAMLRDSEYFLRFLQHDELTRA-------------CQ 195
            |.::|....|.:..:...|:               ||..:.:||.||:.:             .|
  Rat   669 KRIIGPKNYEFLKSKREEFQ---------------EYLQKLVQHPELSNSQLLADFLSPNGGETQ 718

  Fly   196 FLDE--------------------------------------------RRNEMAI--PILENCFR 214
            |||:                                            .|.|:.|  |..||..:
  Rat   719 FLDKILPDVNLGKIIKSVPGKLMKEKGQHLEPFIMSFINSCESPKPKPSRPELTILSPTSENNKK 783

  Fly   215 LLNKIYMNRS 224
            |.|.::.|.:
  Rat   784 LFNDLFKNNA 793

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 20/108 (19%)
Snx14XP_038937462.1 PXA 157..326 CDD:396666
RGS_SNX14 367..493 CDD:188677
PX_SNX14 591..713 CDD:132787 23/123 (19%)
Nexin_C 834..938 CDD:400794
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.