DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and Kif16b

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_038960967.1 Gene:Kif16b / 311478 RGDID:1310146 Length:1876 Species:Rattus norvegicus


Alignment Length:276 Identity:52/276 - (18%)
Similarity:85/276 - (30%) Gaps:105/276 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PGPDEL----DSP---AIEAAALDIPPPESDKALQKGVWERATSAEYKPTTDGSTVLRFDILLAH 79
            |.|:::    :.|   .:|.....:|.........||::..|.:..::|....:.:|.....|..
  Rat  1530 PFPEQMLRLQEDPLTDVLEHMTCSLPELVGMVKAVKGIYWLAVANCFQPDPQAACLLLLPSTLYA 1594

  Fly    80 IMPPDGEDVKIKRFVVYELTVKQD-------------GATED------TQPAKIERR-------- 117
            ::|.|.....:..|.|..|...|:             |:|||      |....:.::        
  Rat  1595 LVPVDSCQSSMNIFHVLPLAALQEIQVGFGGQSIRFLGSTEDLLLTVLTYNKNLTQQLCQDLLGV 1659

  Fly   118 ---------YT-------DFRELYLGLKRQHPA-EMANKYFPAKVLMGNFKSELI-------GER 158
                     ||       |..:|.|.||.:.|. .:||    ...|..||::.|:       |..
  Rat  1660 LMSGSEAAAYTNHPLLHQDLVQLSLDLKAEIPVLALAN----GVQLSSNFQTTLVDMVYFLHGNM 1720

  Fly   159 SAAF-------------------------EAFLTYVASQAMLRDSEYFL-------------RFL 185
            .|:.                         .:|:......|:||:...|.             || 
  Rat  1721 EASVPSLAEVQLLLYTTVRLESEAGCALCRSFILLNTHVALLREDHVFYPRTGSLITLPPHGRF- 1784

  Fly   186 QHDELTRACQFLDERR 201
              |.:|  ||.|.|.|
  Rat  1785 --DVIT--CQALSEFR 1796

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 36/205 (18%)
Kif16bXP_038960967.1 KISc_KIF1A_KIF1B 15..368 CDD:276816
Kinesin_assoc 367..479 CDD:406567
FHA 481..546 CDD:395400
DUF5401 <609..>889 CDD:375164
sbcc <611..>1179 CDD:129705
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.