DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and SNX15

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_037438.2 Gene:SNX15 / 29907 HGNCID:14978 Length:342 Species:Homo sapiens


Alignment Length:325 Identity:68/325 - (20%)
Similarity:98/325 - (30%) Gaps:131/325 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KRFVVYELTV----KQDGATEDTQPAKIERRYTDFRELYLGLKRQH----------PAEMANKYF 141
            |.:..|::|.    |:|  .||.:...:.:||:|||:|:..|...|          ||      |
Human    23 KGYTEYKVTAQFISKKD--PEDVKEVVVWKRYSDFRKLHGDLAYTHRNLFRRLEEFPA------F 79

  Fly   142 PAKVLMGNFKSELIGERSAAFEAFLTYVASQAMLRDSEYFLRFLQHDELT--------------- 191
            |...:.|.|::.:|.||....|..|.:......|.:|.....|.:..|:|               
Human    80 PRAQVFGRFEASVIEERRKGAEDLLRFTVHIPALNNSPQLKEFFRGGEVTRPLEVSRDLHILPPP 144

  Fly   192 ----------RACQFLD-ERR--NEMAIPILENCFRLLNKIYMNRSRPV-----LLILCRLVAAC 238
                      |..|.|. |||  .|:.:|           :....|.|.     ||..|......
Human   145 LIPTPPPDDPRLSQLLPAERRGLEELEVP-----------VDPPPSSPAQEALDLLFNCESTEEA 198

  Fly   239 TSSPV------------------------PHHAAERWALLALSRFETLCDIDLLPLYIPLLHTCA 279
            :.||.                        |.|.||    ||....|: ..:|..|          
Human   199 SGSPARGPLTEAELALFDPFSKEEGAAPSPTHVAE----LATMEVES-ARLDQEP---------- 248

  Fly   280 HLWWQRGQDQKP-----------------ITDRLTDMSKQGINTANTESLMQAIHKI------DP 321
              |...||:::.                 ||..|.| .|.|...|..:.....:|.:      ||
Human   249 --WEPGGQEEEEDGEGGPTPAYLSQATELITQALRD-EKAGAYAAALQGYRDGVHVLLQGVPSDP 310

  Fly   322  321
            Human   311  310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 29/110 (26%)
SNX15NP_037438.2 PX_domain 9..126 CDD:321991 29/110 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..267 5/33 (15%)
MIT_SNX15 267..341 CDD:239140 10/45 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.