DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and Snx15

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001019923.1 Gene:Snx15 / 293691 RGDID:1305803 Length:338 Species:Rattus norvegicus


Alignment Length:304 Identity:66/304 - (21%)
Similarity:100/304 - (32%) Gaps:103/304 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 KRFVVYELTV----KQDGATEDTQPAKIERRYTDFRELYLGLKRQH----------PAEMANKYF 141
            |.:..|::|.    |:|  .||.:...:.:||:|||:|:..|...|          ||      |
  Rat    24 KGYTEYKVTAQFISKKD--PEDIKEVVVWKRYSDFRKLHGDLAYTHRNLFRRLEEFPA------F 80

  Fly   142 PAKVLMGNFKSELIGERSAAFEAFLTYVASQAMLRDSEYFLRFLQHDELTRACQFLDERRNEMAI 206
            |...:.|.|::.:|.||....|..|.:......|.:|.....|.:..|:||.    .|...::.|
  Rat    81 PRAQVFGRFEASVIEERRKGAEDLLRFTVPIPALNNSPQLKEFFRGGEVTRP----SEVSRDLQI 141

  Fly   207 ---PIL----ENCFRLLNKIYMNR--------------SRPV-----LLILCRLVAACTSSPV-- 243
               |::    .:..|||..:...|              |.|.     ||..|......:|||.  
  Rat   142 LPPPLIPTPPSDEARLLQPLPAERRGQEELEVPVDPLPSSPAQEALDLLFCCDSTEEASSSPARG 206

  Fly   244 ----------------------PHHAAERWALLALSR-------------FETLCDIDLLPLYIP 273
                                  |.|.:|..|:...|:             .|...|.|..|.|: 
  Rat   207 PLSEAELALFDPYSKEESTGPSPTHTSELAAMEVQSKRLDQEPWEPGGREEEEAEDGDPAPAYL- 270

  Fly   274 LLHTCAHLWWQRGQDQKPITDRLTDMSKQGINTANTESLMQAIH 317
                        ||..:.||..|.: .|.|...|..:...:.:|
  Rat   271 ------------GQATELITQALRN-EKAGAYAAALQGYQEGVH 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 29/110 (26%)
Snx15NP_001019923.1 PX_domain 10..127 CDD:295365 29/110 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..155 3/20 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..270 5/29 (17%)
MIT_SNX15 268..338 CDD:239140 10/48 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.