DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and RPS6KC1

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_036556.2 Gene:RPS6KC1 / 26750 HGNCID:10439 Length:1066 Species:Homo sapiens


Alignment Length:128 Identity:32/128 - (25%)
Similarity:58/128 - (45%) Gaps:8/128 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 FVVYELT--VKQDGATEDTQPAKIERRYTDFRELYLGLKRQHPAEMA-NKYFP--AK-VLMGNFK 151
            :.||::|  |......||.|...:.:||:||::|:..|.:.|..... ::.||  || ::.|.|.
Human    27 YTVYKVTARVVSRRNPEDVQEIIVWKRYSDFKKLHKELWQIHKNLFRHSELFPPFAKGIVFGRFD 91

  Fly   152 SELIGERSAAFEAFLTYVASQAMLRDSEYFLRFLQHDELTRACQFLD--ERRNEMAIPILENC 212
            ..:|.||....|..|.:.|:...|.:|:....|.:...:..:.:.:.  |..::..|.....|
Human    92 ETVIEERRQCAEDLLQFSANIPALYNSKQLEDFFKGGIINDSSELIGPAEAHSDSLIDTFPEC 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 29/100 (29%)
RPS6KC1NP_036556.2 PX_RPK118_like 11..128 CDD:132820 29/100 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..228
MIT_SNX15 238..312 CDD:239140
PKc_like 335..>421 CDD:304357
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 441..509
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 553..596
S_TKc <875..1056 CDD:214567
STKc_RPK118_like <879..1056 CDD:270728
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.