DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and SGK3

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001028750.1 Gene:SGK3 / 23678 HGNCID:10812 Length:496 Species:Homo sapiens


Alignment Length:101 Identity:38/101 - (37%)
Similarity:51/101 - (50%) Gaps:8/101 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 KIKRFVVYELTVKQDGATEDTQPAKIERRYTDFRELYLGLKRQHPAEMANKYFPAKVLMG-NFKS 152
            |.|||.||::.|.. |.:|    ..:.|||.:|.:||..||:|.|| ||.| .|||.:.| ||..
Human    27 KKKRFTVYKVLVSV-GRSE----WFVFRRYAEFDKLYNTLKKQFPA-MALK-IPAKRIFGDNFDP 84

  Fly   153 ELIGERSAAFEAFLTYVASQAMLRDSEYFLRFLQHD 188
            :.|.:|.|....|:..:.....|.:......|||.|
Human    85 DFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMD 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 37/99 (37%)
SGK3NP_001028750.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PX_CISK 12..120 CDD:132780 37/99 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..156 38/101 (38%)
STKc_SGK3 165..490 CDD:270755
Nuclear localization signal. /evidence=ECO:0000250 195..205
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.