DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and Pxk

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_663433.2 Gene:Pxk / 218699 MGIID:1289230 Length:582 Species:Mus musculus


Alignment Length:286 Identity:64/286 - (22%)
Similarity:100/286 - (34%) Gaps:93/286 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PPDGEDVKIKRFVVYELTVKQDGATEDTQPA--------------------KIERRYTDFREL-- 124
            ||.|:       |:.:.||....|.|.:|..                    :|.|||:||..|  
Mouse     7 PPAGK-------VLLDDTVPLTAAVEASQSLQSHTEYIIRVQRGISAENSWQIVRRYSDFDLLNN 64

  Fly   125 ---YLGLKRQHPAEMANKYFPAKVLMGNFKSELIGERSAAFEAFLTYVASQAMLRDSEYFLRFLQ 186
               ..||...         .|.|.|:||...|.|.||....:.:|..:.:..:|.:.|...:||.
Mouse    65 SLQITGLSLP---------LPPKKLIGNMDREFIAERQRGLQNYLNVIMANHVLSNCELLKKFLD 120

  Fly   187 HDELTR-----ACQ-----FLDERRNEMAIPILENCFRLLNKIYMNRSRPVLLILCRLVAACTSS 241
            .:..:.     |.|     |..|.:.|:..|:.:..:|:..|.::.:                  
Mouse   121 PNNYSANYTEIALQQVSMFFRSEPKWEVVEPLKDIGWRIRKKYFLMK------------------ 167

  Fly   242 PVPHHAAER----WALLALSRFETLCDIDLLPLYIPLLHTCAHLWWQRGQDQKPITDRLT----- 297
             :.:...||    ||.|...::  |.|.|...| |.||.:|.|          |...|:|     
Mouse   168 -IKNQPKERLVLSWADLGPDKY--LSDKDFQCL-IKLLPSCVH----------PYIYRVTFATAS 218

  Fly   298 DMSKQGINTANTE-SLMQAIHKIDPR 322
            :.|...|...|.: :|...|:|..|:
Mouse   219 ESSALLIRAFNEKGTLKDLIYKAKPK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 32/130 (25%)
PxkNP_663433.2 PX_MONaKA 13..132 CDD:132781 28/127 (22%)
PKc 198..345 CDD:270622 15/57 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 433..550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.