Sequence 1: | NP_608709.1 | Gene: | Snx21 / 33466 | FlyBaseID: | FBgn0031457 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006515125.3 | Gene: | Snx13 / 217463 | MGIID: | 2661416 | Length: | 1144 | Species: | Mus musculus |
Alignment Length: | 203 | Identity: | 43/203 - (21%) |
---|---|---|---|
Similarity: | 80/203 - (39%) | Gaps: | 39/203 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 TFDGDPPGPDELDSPAIEAAALDIPPPESDKALQKGVWERAT-SAEYKPTTDGSTVLRFDILLAH 79
Fly 80 IMPPDGEDVKIKRFVVYELTV-KQDGATEDTQPAKIERRYTDFRELYLGLKRQHPAEMANKYFPA 143
Fly 144 KVLMGNFKSELIGERSAAFEAFLTYVASQAMLRDSEYFLR----FLQH--------DELTRACQF 196
Fly 197 LDERRNEM 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Snx21 | NP_608709.1 | PX_SNX20_21_like | 71..188 | CDD:132812 | 25/129 (19%) |
Snx13 | XP_006515125.3 | PHA03381 | 6..>146 | CDD:177618 | |
PXA | 273..460 | CDD:214611 | |||
RGS_SNX13 | 553..687 | CDD:188674 | |||
PX_SNX13 | 733..863 | CDD:132783 | 30/147 (20%) | ||
Nexin_C | 979..1087 | CDD:370015 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2101 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |