DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and Snx13

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_006515125.3 Gene:Snx13 / 217463 MGIID:2661416 Length:1144 Species:Mus musculus


Alignment Length:203 Identity:43/203 - (21%)
Similarity:80/203 - (39%) Gaps:39/203 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TFDGDPPGPDELDSPAIEAAALDIPPPESDKALQKGVWERAT-SAEYKPTTDGSTVLRFDILLAH 79
            :|:|.|.|       :|..:..|:....||.::|...:...| .|:|.|           ..:|.
Mouse   710 SFNGSPTG-------SINLSLDDLSSVTSDDSVQLHAYISDTVYADYDP-----------YAVAG 756

  Fly    80 IMPPDGEDVKIKRFVVYELTV-KQDGATEDTQPAKIERRYTDFRELYLGLKRQHPAEMANKYFPA 143
            :....|     |.:.:|.:|| :::..||:..  |..|||:||.:.::.:..|.....:....|.
Mouse   757 VCNDHG-----KTYALYAITVHRRNLNTEEMW--KTYRRYSDFHDFHMRITEQFENLSSILKLPG 814

  Fly   144 KVLMGNFKSELIGERSAAFEAFLTYVASQAMLRDSEYFLR----FLQH--------DELTRACQF 196
            |....|...:.:.:|.....|:|..:.:..|::.|.....    ||::        |...:...|
Mouse   815 KKTFNNMDRDFLEKRKKDLNAYLQLLLTPEMMKASPALAHCVYDFLENKAYSKGKGDFARKMDTF 879

  Fly   197 LDERRNEM 204
            ::..||.|
Mouse   880 VNPLRNSM 887

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 25/129 (19%)
Snx13XP_006515125.3 PHA03381 6..>146 CDD:177618
PXA 273..460 CDD:214611
RGS_SNX13 553..687 CDD:188674
PX_SNX13 733..863 CDD:132783 30/147 (20%)
Nexin_C 979..1087 CDD:370015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.