DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and snx-13

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_503026.3 Gene:snx-13 / 178482 WormBaseID:WBGene00013803 Length:940 Species:Caenorhabditis elegans


Alignment Length:185 Identity:42/185 - (22%)
Similarity:80/185 - (43%) Gaps:39/185 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 FVVYELTVKQDGATEDTQPAKIERRYTDFRELYLGLKRQHPAEMANKYFPAKVLMGNFKSELIGE 157
            :.:|.:.|.:.....:.....:.|||:||..|:..|.::.| :::...||.|....|..:|.:.:
 Worm   585 YALYNVRVSRCVNGREVSSWNVIRRYSDFHTLHQVLVQKFP-KLSTLSFPGKKTFNNLDNEFLEK 648

  Fly   158 RSAAFEAFLTYVASQAMLR-----DSEYF-----LRFLQHDELTRACQFL----DERRN------ 202
            |:.|...:|:.:....:||     |...|     .::...:.||:  :|:    |..||      
 Worm   649 RTKALNMYLSCILQPHLLRNYPEMDRHVFDFLSQKKYANSNPLTK--KFMSAMFDPIRNGVKAVG 711

  Fly   203 --EMAIP--ILENCFRL---LN---KIYMNRS------RPVLLILCRLVAACTSS 241
              .||:|  :.|...::   :|   ||.:|.|      ||.::...|:.|:.|.:
 Worm   712 TTVMAVPDQVFEGVTKMGVGINNAAKIIINPSSSSTVNRPPVMETDRVAASLTDT 766

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 22/104 (21%)
snx-13NP_503026.3 PXA 95..283 CDD:280373
RGS_SNX13 380..510 CDD:188674
PX_domain 564..683 CDD:295365 22/98 (22%)
Nexin_C 791..899 CDD:285792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.