DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and nish-1

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_502016.2 Gene:nish-1 / 177981 WormBaseID:WBGene00008750 Length:497 Species:Caenorhabditis elegans


Alignment Length:120 Identity:26/120 - (21%)
Similarity:51/120 - (42%) Gaps:34/120 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 RFVVYELTVKQDGATEDTQPAKIERRYTDF--RELYLGLKRQHPAEMANKYFPAKVLMGNFKSEL 154
            ::.||.:.:     |.||....:||||:||  .:::..|.|:      ..:.|.|..:||...|.
 Worm    31 KYTVYRIQI-----TVDTYTWTVERRYSDFDAYDVHRFLDRK------KSFLPPKKRLGNKDLEF 84

  Fly   155 IGERSAAFEAFLTYVASQAMLRDSEYFLRFLQHDELTRACQFLDERRNEMAIPIL 209
            |.||....|.::     :|:|....::                .:::|..::|::
 Worm    85 IEERRLELEKYV-----RALLELEVWY----------------QKQKNVHSLPLI 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 24/97 (25%)
nish-1NP_502016.2 PX_domain 18..137 CDD:383026 26/120 (22%)
LRR <289..423 CDD:227223
leucine-rich repeat 291..313 CDD:275380
leucine-rich repeat 314..336 CDD:275380
leucine-rich repeat 337..359 CDD:275380
leucine-rich repeat 360..381 CDD:275380
leucine-rich repeat 382..406 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.