DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and Kif16b

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_036014693.1 Gene:Kif16b / 16558 MGIID:1098240 Length:1908 Species:Mus musculus


Alignment Length:362 Identity:70/362 - (19%)
Similarity:113/362 - (31%) Gaps:133/362 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PGPDEL----DSP---AIEAAALDIPPPESDKALQKGVWERATSAEYKPTTDGSTVLRFDILLAH 79
            |.|:::    :.|   .:|.....:|.|.......||::..|.:...:|....:.:|....:|..
Mouse  1562 PFPEQMLRLQECPLTDLLEHMTCCLPEPVDIMKAVKGIYWLAVANCSQPDPQAACLLLLPSILYA 1626

  Fly    80 IMPPDGEDVKIKRFVVYELTVKQD-------------GATED----------------------- 108
            ::..||....:..|....||..|:             |:|||                       
Mouse  1627 LVLVDGCPGSMSTFHALPLTALQEIQVGFGGQSIRFLGSTEDLLLTVLTYNKSLTQQLCQDLLGV 1691

  Fly   109 ----TQPAKIERR---YTDFRELYLGLKRQHPA-EMAN---------------KYFPAKVLMGNF 150
                ::.|.....   :.|..:|.|.||.:.|. .:||               .||    |.||.
Mouse  1692 LMAGSEAAAYSNHPLLHQDLVQLSLDLKAEIPVLALANGVQLSCNFQTTLVDMVYF----LHGNM 1752

  Fly   151 KSELIG--------------ERSAAFEAFLTYV---ASQAMLRDSEYFL-------------RFL 185
            ::.:..              |..||....|:::   ...|:||:...|.             || 
Mouse  1753 EASVPSLAEVQLLLYTTVRLESEAACAPCLSFILLNTHMALLREDHVFYPHTGSLNTLPPHGRF- 1816

  Fly   186 QHDELTRACQFLDERR-----NEMAIPILENCFRLLNKIYMNR-------SRPVLLILCRLVAAC 238
              |.:|  ||.|.|.|     .:..:..:|..|...:.:.:||       ||         |.:.
Mouse  1817 --DVIT--CQALSEFRCVIVPEKDKVSKVELVFLRKHGLPLNRGSGLPEQSR---------VTSS 1868

  Fly   239 TSSPVP-------HHAAERWALLALSRFETLCDIDLL 268
            |...:|       ..|.:.|.|...|:.|.|..|..|
Mouse  1869 TQVVIPLCLEDGQDQALDIWKLTFNSQDEALWLISYL 1905

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 36/205 (18%)
Kif16bXP_036014693.1 KISc_KIF1A_KIF1B 51..399 CDD:276816
Kinesin_assoc 398..510 CDD:406567
FHA 512..577 CDD:395400
SbcC <644..1081 CDD:223496
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.