DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and SNX20

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_878274.1 Gene:SNX20 / 124460 HGNCID:30390 Length:316 Species:Homo sapiens


Alignment Length:322 Identity:90/322 - (27%)
Similarity:128/322 - (39%) Gaps:68/322 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PIHAVMAKRLHHQPTFDGD--PPGPD-ELDSPAIEAAALDIPPPESDKALQKGVWERATSAEYKP 63
            ||....|:.....|....|  .|||| .||:    .:.|......:.:.||: .|:. ....:| 
Human    15 PITQCTARTQQEAPATGPDLPHPGPDGHLDT----HSGLSSNSSMTTRELQQ-YWQN-QKCRWK- 72

  Fly    64 TTDGSTVLRFDILLAHIMPPDGEDVKIKRFVVYELTVKQDGATEDTQPAKIERRYTDFRELYLGL 128
                ...|.|:|..|.|     |:.|:.:||||::.|.|.|:. |...|.:||||:||.:|...|
Human    73 ----HVKLLFEIASARI-----EERKVSKFVVYQIIVIQTGSF-DNNKAVLERRYSDFAKLQKAL 127

  Fly   129 KRQHPAEMANKYFPAKVLMGNFKSELIGERSAAFEAFLTYVASQAMLRDSEYFLRFLQHDELTRA 193
            .:....|:.:..||.|.|.|||..|:|.||..|.:.:|..:.:...:|.|..||.||...||..|
Human   128 LKTFREEIEDVEFPRKHLTGNFAEEMICERRRALQEYLGLLYAIRCVRRSREFLDFLTRPELREA 192

  Fly   194 CQFLDERRNEMAIPILENCFRLLNKIYMNRSRPVLLILCRLVAACTSSPVPHHAAERWALLALSR 258
            ...|...:...|:.:|.....|..|               |.|.|.::.||       ||.|:  
Human   193 FGCLRAGQYPRALELLLRVLPLQEK---------------LTAHCPAAAVP-------ALCAV-- 233

  Fly   259 FETLCDIDL-LP---------------------LYIPLLHTCAHLWWQRGQDQKPITDRLTD 298
              .||..|| .|                     .|.|||.....|.:..|:|...:.:||.:
Human   234 --LLCHRDLDRPAEAFAAGERALQRLQAREGHRYYAPLLDAMVRLAYALGKDFVTLQERLEE 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 44/116 (38%)
SNX20NP_878274.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..54 9/34 (26%)
PX_SNX20 76..189 CDD:132833 44/118 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159819
Domainoid 1 1.000 65 1.000 Domainoid score I10058
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5147
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49711
OrthoDB 1 1.010 - - D1322681at2759
OrthoFinder 1 1.000 - - FOG0004256
OrthoInspector 1 1.000 - - otm40579
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20939
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.