Sequence 1: | NP_608709.1 | Gene: | Snx21 / 33466 | FlyBaseID: | FBgn0031457 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001359271.1 | Gene: | Snx25 / 102141 | MGIID: | 2142610 | Length: | 986 | Species: | Mus musculus |
Alignment Length: | 251 | Identity: | 47/251 - (18%) |
---|---|---|---|
Similarity: | 86/251 - (34%) | Gaps: | 76/251 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 EAAALDIPPPESDKALQK-GVWERATSAEYKPTTDGSTVLRFDILLAHIMPPDGEDVKIKRFVVY 96
Fly 97 ELTVKQDGATEDTQPAKIERRYTDFRELYLGLKRQHPAEMANKYFP--AKVLMGNFKSELIGERS 159
Fly 160 AAFEAFLTYVASQAMLRDSEYFLRFL-----------------------------------QHDE 189
Fly 190 LTRACQF------LDERRNEMAIPILENCFRLLNKIYMNRS-----RPVLLILCRL 234 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Snx21 | NP_608709.1 | PX_SNX20_21_like | 71..188 | CDD:132812 | 29/153 (19%) |
Snx25 | NP_001359271.1 | PXA | 148..303 | CDD:366970 | |
RGS | 437..545 | CDD:383028 | |||
End3 | <558..645 | CDD:372297 | 3/9 (33%) | ||
PX_SNX25 | 648..770 | CDD:132788 | 30/144 (21%) | ||
Nexin_C | 847..950 | CDD:370015 | 3/12 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2101 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |