DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and Snx25

DIOPT Version :10

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001359271.1 Gene:Snx25 / 102141 MGIID:2142610 Length:986 Species:Mus musculus


Alignment Length:251 Identity:47/251 - (18%)
Similarity:86/251 - (34%) Gaps:76/251 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EAAALDIPPPESDKALQK-GVWERATSAEYKPTTDGSTVLRFDILLAHIMPPDGEDVKIKRFVVY 96
            |..||.:....:|...:. |:|                  |..|..|.:...:||.:.. .||  
Mouse   635 ECTALQLHMARTDWWCENLGLW------------------RASITSAEVTEENGEQMPC-YFV-- 678

  Fly    97 ELTVKQDGATEDTQPAKIERRYTDFRELYLGLKRQHPAEMANKYFP--AKVLMGNFKSELIGERS 159
            .:.:::.|..| |:...:.||.::|:.|:..|....|: :.....|  :|:...:...:.:|:..
Mouse   679 RVNLQEVGGVE-TKNWTVPRRLSEFQNLHRKLSECVPS-LKKVQLPSLSKLPFKSIDHKFLGKSR 741

  Fly   160 AAFEAFLTYVASQAMLRDSEYFLRFL-----------------------------------QHDE 189
            ....|||..:.|...|..||....||                                   |.:|
Mouse   742 NQLNAFLQNLLSDERLFQSEALYAFLSPSPDYLKVIDVQGKKTSFSLSSFLEKLPRDFFSHQEEE 806

  Fly   190 LTRACQF------LDERRNEMAIPILENCFRLLNKIYMNRS-----RPVLLILCRL 234
            :......      :|.:::.:|.|    ||.|:.:|:..|.     |..|:.|.::
Mouse   807 IEEDSDLSDYGDDVDGKKDSLAEP----CFMLIGEIFELRGMFKWVRRTLIALVQV 858

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 29/153 (19%)
Snx25NP_001359271.1 PXA 148..303 CDD:460484
RGS 437..545 CDD:470619
PX_SNX25 648..770 CDD:132788 30/144 (21%)
Nexin_C 847..950 CDD:462541 3/12 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.