DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and Snx25

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001359271.1 Gene:Snx25 / 102141 MGIID:2142610 Length:986 Species:Mus musculus


Alignment Length:251 Identity:47/251 - (18%)
Similarity:86/251 - (34%) Gaps:76/251 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 EAAALDIPPPESDKALQK-GVWERATSAEYKPTTDGSTVLRFDILLAHIMPPDGEDVKIKRFVVY 96
            |..||.:....:|...:. |:|                  |..|..|.:...:||.:.. .||  
Mouse   635 ECTALQLHMARTDWWCENLGLW------------------RASITSAEVTEENGEQMPC-YFV-- 678

  Fly    97 ELTVKQDGATEDTQPAKIERRYTDFRELYLGLKRQHPAEMANKYFP--AKVLMGNFKSELIGERS 159
            .:.:::.|..| |:...:.||.::|:.|:..|....|: :.....|  :|:...:...:.:|:..
Mouse   679 RVNLQEVGGVE-TKNWTVPRRLSEFQNLHRKLSECVPS-LKKVQLPSLSKLPFKSIDHKFLGKSR 741

  Fly   160 AAFEAFLTYVASQAMLRDSEYFLRFL-----------------------------------QHDE 189
            ....|||..:.|...|..||....||                                   |.:|
Mouse   742 NQLNAFLQNLLSDERLFQSEALYAFLSPSPDYLKVIDVQGKKTSFSLSSFLEKLPRDFFSHQEEE 806

  Fly   190 LTRACQF------LDERRNEMAIPILENCFRLLNKIYMNRS-----RPVLLILCRL 234
            :......      :|.:::.:|.|    ||.|:.:|:..|.     |..|:.|.::
Mouse   807 IEEDSDLSDYGDDVDGKKDSLAEP----CFMLIGEIFELRGMFKWVRRTLIALVQV 858

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 29/153 (19%)
Snx25NP_001359271.1 PXA 148..303 CDD:366970
RGS 437..545 CDD:383028
End3 <558..645 CDD:372297 3/9 (33%)
PX_SNX25 648..770 CDD:132788 30/144 (21%)
Nexin_C 847..950 CDD:370015 3/12 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.