DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snx21 and snx20

DIOPT Version :9

Sequence 1:NP_608709.1 Gene:Snx21 / 33466 FlyBaseID:FBgn0031457 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_012817668.1 Gene:snx20 / 100495982 XenbaseID:XB-GENE-6036221 Length:326 Species:Xenopus tropicalis


Alignment Length:252 Identity:71/252 - (28%)
Similarity:120/252 - (47%) Gaps:23/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 WERATSAEYKPTTDGSTVLRFDILLAHIMPPDGEDVKIKRFVVYELTVKQDGATEDTQPAKIERR 117
            |::...:. ||.|     |.|:|..|.|    .||. :.:||||::.:.:.|:.::.. ..||||
 Frog    71 WKKEKHSS-KPDT-----LLFEIQSARI----AEDF-LSKFVVYQIVIIRTGSFDENN-VFIERR 123

  Fly   118 YTDFRELYLGLKRQHPAEMANKYFPAKVLMGNFKSELIGERSAAFEAFLTYVASQAMLRDSEYFL 182
            |:||.:|:..|.::...||.:..||.|||:|||.:::|.:|....:.:|..:.:...:|.|:.::
 Frog   124 YSDFEKLHRTLLKEFKEEMEDVVFPKKVLIGNFTTDMISKRMLCLKNYLDELYAIKYIRWSKIYI 188

  Fly   183 RFLQHDELTRACQFLDERRNEMAIPILENCFRLLNKIYMNRSRPVLLILCRLVAACTSSPVPHHA 247
            .|....||......|...:.:.|..|.:....|..|:..:.|..::..||.|| .|.........
 Frog   189 DFFLDPELDEGYSCLRGGQYKKATEIFQQIVCLQEKLIQHCSILIVPPLCALV-VCHKDLEDLQK 252

  Fly   248 AERWALLALSRFETLCDIDLLP---LYIPLLHTCAHLWWQRGQDQKPITDRLTDMSK 301
            |....:.||    ||  ::..|   .|||||.|...|.::.|:|...:.::. |:.|
 Frog   253 AYEVGIHAL----TL--VEKHPGHKYYIPLLETLISLAYKLGKDFLSLREKF-DIGK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snx21NP_608709.1 PX_SNX20_21_like 71..188 CDD:132812 37/116 (32%)
snx20XP_012817668.1 PX_domain 83..196 CDD:383026 37/118 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1322681at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.