DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33514 and PDR17

DIOPT Version :9

Sequence 1:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_014135.1 Gene:PDR17 / 855457 SGDID:S000005208 Length:350 Species:Saccharomyces cerevisiae


Alignment Length:263 Identity:53/263 - (20%)
Similarity:94/263 - (35%) Gaps:73/263 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IRPLTPEL---QKVAKEQLKEDPERLEADLQAFKTWIEQQPHLNPRMDDQFLVAFLRGCKYSLER 66
            |:.||..|   :::.....|||.:.|.||    |..:|.:      ...|.::.|        :.
Yeast   110 IKGLTKTLVWRREIGLTHGKEDKDPLTAD----KVAVENE------TGKQVILGF--------DN 156

  Fly    67 AKSKLDKYYTLKTKYPDYFRVTNTTDSKFREIHQTGAIIYLPTPLNENGPRIGIWRMGLVPVEKY 131
            ||..|  ||....:        ..|:|.||::.:   ::|:........|:         .|||.
Yeast   157 AKRPL--YYMKNGR--------QNTESSFRQVQE---LVYMMETATTVAPQ---------GVEKI 199

  Fly   132 TML--------------ECMQVAQAMQEIAILEDDYANVNGVVFIMDMKGATAAHLFQMTPSM-- 180
            |:|              :...::.|...:.:::|.|........::::.....|.|..|.|.:  
Yeast   200 TVLVDFKSYKEPGIITDKAPPISIARMCLNVMQDHYPERLAKCVLINIPWFAWAFLKMMYPFLDP 264

  Fly   181 -AKKFTVFSE----EALPLRLKAQHFINTITGFEQLFNMFKPMMSKKMQ-------SRLFVHGNK 233
             .|...:|.|    ...|.:|.|.:  |.:..|:....::.|.|.||:.       .|....|..
Yeast   265 ATKAKAIFDEPFENHIEPSQLDALY--NGLLDFKYKHEVYWPDMVKKVDDLRLKRFDRFLKFGGI 327

  Fly   234 MGL 236
            :||
Yeast   328 VGL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 9/45 (20%)
SEC14 97..253 CDD:238099 30/168 (18%)
PDR17NP_014135.1 CRAL_TRIO_N 49..115 CDD:397711 2/4 (50%)
CRAL_TRIO 146..291 CDD:395525 31/176 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343344
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.