DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33514 and SFH5

DIOPT Version :9

Sequence 1:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_012390.1 Gene:SFH5 / 853296 SGDID:S000003681 Length:294 Species:Saccharomyces cerevisiae


Alignment Length:249 Identity:47/249 - (18%)
Similarity:100/249 - (40%) Gaps:54/249 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LRGCKYSLE-RAKSKLDKYYTLKT--------------KYP----------DYFRVTNTTDSKFR 96
            |.|.|.:.| ..:.::||||..|.              :|.          ::.|..|.....::
Yeast    33 LYGYKLNPEGLTQEEVDKYYDEKIADRLTYKLCKAYQFEYSTIVQNLIDILNWRREFNPLSCAYK 97

  Fly    97 EIHQT-----GAIIYLPTPLNENG---PRIGIWRMGLVPVEKYTMLECM------QVAQAMQEIA 147
            |:|.|     |.:.:     :.||   .:...|.:....|:|..:.:.:      ::....:.::
Yeast    98 EVHNTELQNVGILTF-----DANGDANKKAVTWNLYGQLVKKKELFQNVDKFVRYRIGLMEKGLS 157

  Fly   148 ILEDDYANVNGVVFIMDMKGATAAHLFQMTPSMAKKFTVFSEEALPLRLKAQHFINTITGFEQLF 212
            :|:...::.|.:..:.|.||.:...:.....:.:|......::..|..|.|::|:|..|.|..::
Yeast   158 LLDFTSSDNNYMTQVHDYKGVSVWRMDSDIKNCSKTVIGIFQKYYPELLYAKYFVNVPTVFGWVY 222

  Fly   213 NMFKPMMSKKMQSRLFV--HGNKMGLLTEQIPLKYLPEEYGGE----NGTTQDI 260
            ::.|..:.:..:.:..|  .|:|:|...:..|.    |.|||:    |.|.|::
Yeast   223 DLIKKFVDETTRKKFVVLTDGSKLGQYLKDCPY----EGYGGKDKKNNLTKQNV 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 5/17 (29%)
SEC14 97..253 CDD:238099 31/171 (18%)
SFH5NP_012390.1 SEC14 101..263 CDD:214706 30/170 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.