DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33514 and Sec14l1

DIOPT Version :9

Sequence 1:NP_001014558.1 Gene:CG33514 / 3346239 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster
Sequence 2:NP_083053.2 Gene:Sec14l1 / 74136 MGIID:1921386 Length:719 Species:Mus musculus


Alignment Length:293 Identity:52/293 - (17%)
Similarity:105/293 - (35%) Gaps:84/293 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AKEQLKEDP-ERLEAD----------------LQAFKTWIEQQPHLNPRMDDQFLVAFLRGCKYS 63
            |.|.:...| ::|:||                |...:.|: |:.|......|:.::.|||...::
Mouse   227 ASEPVVGTPDDKLDADYIKRYLGDLTPLQESCLIRLRQWL-QETHKGKIPKDEHILRFLRARDFN 290

  Fly    64 LERAKSKLDKYYTLKTKYPDYFRVTNTTDSKFREIHQTGAIIYLPTP--------------LNEN 114
            :::|:..:.:..|                  :|:.||...|:...||              .:::
Mouse   291 IDKAREIMCQSLT------------------WRKQHQVDYILDTWTPPQVLLDYYAGGWHHHDKD 337

  Fly   115 GPRIGIWRMGLVPVEKYTMLECMQVAQAMQEIAILEDDYA---NVNGV--------VF------- 161
            |..:.:.|:|        .::...:.:|:.|.|:|.  |.   |..|:        ||       
Mouse   338 GRPLYVLRLG--------QMDTKGLVRALGEEALLR--YVLSINEEGLRRCEENTKVFGRPISSW 392

  Fly   162 --IMDMKGATAAHLFQMTPSMAKKFTVFSEEALPLRLKAQHFINTITGFEQLFNMFKPMMSKKMQ 224
              ::|::|....||::.......:.....|...|..|.....:.....|..|:.:..|.:....:
Mouse   393 TCLVDLEGLNMRHLWRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNTR 457

  Fly   225 SRLFVH-GNKM---GLLTEQIPLKYLPEEYGGE 253
            .:..:: ||..   |.|.:.|..:.:|:...||
Mouse   458 RKFLIYAGNDYQGPGGLLDYIDKEIIPDFLSGE 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 11/61 (18%)
SEC14 97..253 CDD:238099 33/193 (17%)
Sec14l1NP_083053.2 Required for interaction and inhibitory function toward DDX58. /evidence=ECO:0000250|UniProtKB:Q92503 1..510 52/293 (18%)
PRELI 17..173 CDD:282550
CRAL_TRIO_N 256..301 CDD:215024 9/45 (20%)
CRAL_TRIO 326..490 CDD:279044 28/173 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.